Proteasome 20S alpha 3 Antibody - BSA Free

Images

 
Western Blot: Proteasome 20S alpha 3 Antibody [NBP1-92293] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: Proteasome 20S alpha 3 Antibody [NBP1-92293] - Staining of human cell line U-251 MG shows localization to microtubules. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Proteasome 20S alpha 3 Antibody [NBP1-92293] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.
Western Blot: Proteasome 20S alpha 3 Antibody [NBP1-92293] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17Lane 2: Human cell line RT-4
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Proteasome 20S alpha 3 Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit Proteasome 20S alpha 3 Antibody - BSA Free (NBP1-92293) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Proteasome 20S alpha 3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYIVHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Proteasome 20S alpha 3 Recombinant Protein Antigen (NBP1-92293PEP)
Publications
Read Publication using NBP1-92293.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Proteasome 20S alpha 3 Antibody - BSA Free

  • EC 3.4.25.1
  • HC8
  • HC8MGC32631
  • Macropain subunit C8
  • MGC12306
  • Multicatalytic endopeptidase complex subunit C8
  • proteasome (prosome, macropain) subunit, alpha type, 3
  • Proteasome 20S alpha 3
  • Proteasome component C8
  • proteasome subunit alpha type-3
  • proteasome subunit C8
  • PSC3
  • PSC8
  • PSMA3

Background

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01608
Species: Hu, Pm, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP1-92292
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, WB
NBP3-16514
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-32387
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-03836
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-81768
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
H00003087-M02
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-92294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89714
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-16686
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-20053
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-49118
Species: Hu
Applications: IHC,  IHC-P
AF2818
Species: Hu
Applications: ICC, WB
MAB6529
Species: Hu
Applications: Simple Western, WB
AF6240
Species: Hu
Applications: ELISA, IHC, WB
NBP1-31470
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB

Publications for Proteasome 20S alpha 3 Antibody (NBP1-92293)(1)

Reviews for Proteasome 20S alpha 3 Antibody (NBP1-92293) (0)

There are no reviews for Proteasome 20S alpha 3 Antibody (NBP1-92293). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Proteasome 20S alpha 3 Antibody (NBP1-92293) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Proteasome 20S alpha 3 Products

Research Areas for Proteasome 20S alpha 3 Antibody (NBP1-92293)

Find related products by research area.

Blogs on Proteasome 20S alpha 3

There are no specific blogs for Proteasome 20S alpha 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Proteasome 20S alpha 3 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMA3