PSMA2 Antibody

Images

 
Western Blot: PSMA2 Antibody [NBP1-92292] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunohistochemistry-Paraffin: PSMA2 Antibody [NBP1-92292] - Staining of human testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts.
Western Blot: PSMA2 Antibody [NBP1-92292] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: PSMA2 Antibody [NBP1-92292] - Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.
Immunohistochemistry-Paraffin: PSMA2 Antibody [NBP1-92292] - Staining of human cervix, uterine shows no positivity in squamous epithelial cells as expected.
Immunohistochemistry-Paraffin: PSMA2 Antibody [NBP1-92292] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PSMA2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PSMA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Proteasome 20S alpha 2 Protein (NBP1-92292PEP)
Publications
Read Publication using NBP1-92292.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23436904)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PSMA2 Antibody

  • HC3
  • MU
  • PMSA2
  • PSC3
  • PSMA2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-80461
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-19561
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-56929
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-90309
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB
NB100-74635
Species: Hu
Applications: IHC, IHC-P, IP, WB (-)
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-90824
Species: Hu
Applications: ICC/IF, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-81555
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-92292
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, KD

Publications for Proteasome 20S alpha 2 Antibody (NBP1-92292)(1)

Reviews for Proteasome 20S alpha 2 Antibody (NBP1-92292) (0)

There are no reviews for Proteasome 20S alpha 2 Antibody (NBP1-92292). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Proteasome 20S alpha 2 Antibody (NBP1-92292) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PSMA2 Products

Bioinformatics Tool for Proteasome 20S alpha 2 Antibody (NBP1-92292)

Discover related pathways, diseases and genes to Proteasome 20S alpha 2 Antibody (NBP1-92292). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Proteasome 20S alpha 2 Antibody (NBP1-92292)

Discover more about diseases related to Proteasome 20S alpha 2 Antibody (NBP1-92292).
 

Pathways for Proteasome 20S alpha 2 Antibody (NBP1-92292)

View related products by pathway.

PTMs for Proteasome 20S alpha 2 Antibody (NBP1-92292)

Learn more about PTMs related to Proteasome 20S alpha 2 Antibody (NBP1-92292).
 

Research Areas for Proteasome 20S alpha 2 Antibody (NBP1-92292)

Find related products by research area.

Blogs on PSMA2

There are no specific blogs for PSMA2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PSMA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMA2