Prokineticin R1/PROKR1 Antibody


Western Blot: Prokineticin R1/PROKR1 Antibody [NBP1-83337] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate more
Immunohistochemistry-Paraffin: Prokineticin R1/PROKR1 Antibody [NBP1-83337] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Prokineticin R1/PROKR1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: GFMDDNATNTSTSFLSVLNPHGAHATSFPFNFSYSDYDMPLDEDEDVTNSRTFF
Specificity of human Prokineticin R1/PROKR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Prokineticin R1/PROKR1 Protein (NBP1-83337PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Prokineticin R1/PROKR1 Antibody

  • G protein-coupled receptor 73
  • G protein-coupled receptor ZAQ
  • GPR73
  • GPR73a
  • GPR73aG-protein coupled receptor 73
  • PKR1
  • PK-R1
  • PKR1G-protein coupled receptor ZAQ
  • Prokineticin R1
  • prokineticin receptor 1
  • ProkineticinR1
  • PROKR1
  • ZAQ


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Bv
Applications: WB, ELISA, ICC/IF, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Prokineticin R1/PROKR1 Antibody (NBP1-83337) (0)

There are no publications for Prokineticin R1/PROKR1 Antibody (NBP1-83337).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Prokineticin R1/PROKR1 Antibody (NBP1-83337) (0)

There are no reviews for Prokineticin R1/PROKR1 Antibody (NBP1-83337). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Prokineticin R1/PROKR1 Antibody (NBP1-83337) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Prokineticin R1/PROKR1 Products

Bioinformatics Tool for Prokineticin R1/PROKR1 Antibody (NBP1-83337)

Discover related pathways, diseases and genes to Prokineticin R1/PROKR1 Antibody (NBP1-83337). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Prokineticin R1/PROKR1 Antibody (NBP1-83337)

Discover more about diseases related to Prokineticin R1/PROKR1 Antibody (NBP1-83337).

Pathways for Prokineticin R1/PROKR1 Antibody (NBP1-83337)

View related products by pathway.

PTMs for Prokineticin R1/PROKR1 Antibody (NBP1-83337)

Learn more about PTMs related to Prokineticin R1/PROKR1 Antibody (NBP1-83337).

Research Areas for Prokineticin R1/PROKR1 Antibody (NBP1-83337)

Find related products by research area.

Blogs on Prokineticin R1/PROKR1

There are no specific blogs for Prokineticin R1/PROKR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Prokineticin R1/PROKR1 Antibody and receive a gift card or discount.


Gene Symbol PROKR1