Novus Biologicals Rabbit Prokineticin R1/PROKR1 Antibody - BSA Free (NBP1-83337) is a polyclonal antibody validated for use in IHC. Anti-Prokineticin R1/PROKR1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GFMDDNATNTSTSFLSVLNPHGAHATSFPFNFSYSDYDMPLDEDEDVTNSRTFF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PROKR1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for Prokineticin R1/PROKR1 Antibody - BSA Free
G protein-coupled receptor 73
G protein-coupled receptor ZAQ
GPR73
GPR73a
GPR73aG-protein coupled receptor 73
PKR1
PK-R1
PKR1G-protein coupled receptor ZAQ
Prokineticin R1
prokineticin receptor 1
ProkineticinR1
PROKR1
ZAQ
Background
PKR (protein kinase, activatable by RNA) is a double-stranded (ds) RNA-activated protein kinase that plays a key role in the innate immunity response to viral infection in higher eukaryotes (reviewed in Langland et al, 2006). PKR contains an N-terminal dsRNA-binding domain that consists of consensus dsRNA-binding motifs and a C-terminal kinase domain containing conserved motifs for protein kinase activity. DsRNA is a well characterized danger signal that the cell uses recognize the presence of viral infection. PKR binds to dsRNA molecules during viral infection and triggers antiviral innate defense mechanisms including the induction of type I interferons and downregulation of gene expression. One of the most well characterized substrates of activated PKR is the eukaryotic tranlation initiation facter, eIF2. PKR phosphorylates eIF2 during virus infection, which ultimately leads to an inhibition in protein synthesis and block in viral replication. The key role played by PKR in innate responses to viral infections is underscored by the large number of DNA and RNA viruses, whose hosts range from insects to humans, that code for PKR inhibitors. PKR is also known as PRKR, EIF2AK1, and EIF2AK2. Recognizes PKR; human PKR is 942 amino acid protein.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Noda K, Dufner B, Ito H et al. Differential inflammation-mediated function of prokineticin 2 in the synovial fibroblasts of patients with rheumatoid arthritis compared to osteoarthritis Sci Rep
Reviews for Prokineticin R1/PROKR1 Antibody (NBP1-83337) (0)
There are no reviews for Prokineticin R1/PROKR1 Antibody (NBP1-83337).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Prokineticin R1/PROKR1 Antibody - BSA Free and receive a gift card or discount.