PRODH Antibody (3A9)

Images

 
Immunohistochemistry-Paraffin: PRODH Antibody (3A9) [H00005625-M01] - Analysis of monoclonal antibody to PRODH on formalin-fixed paraffin-embedded human endometrium. Antibody concentration 3 ug/ml.
ELISA: PRODH Antibody (3A9) [H00005625-M01] - Detection limit for recombinant GST tagged PRODH is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
3A9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PRODH Antibody (3A9) Summary

Immunogen
PRODH (NP_057419 441 a.a. - 540 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LVRGAYLAQERARAAEIGYEDPINPTYEATNAMYHRCLDYVLEELKHNAKAKVMVASHNEDTVRFALRRMEELGLHPADHRVYFGQLLGMCDQISFPLGQ
Specificity
PRODH - proline dehydrogenase (oxidase) 1 (3A9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PRODH
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PRODH Antibody (3A9)

  • EC 1.5.99.8
  • FLJ33744
  • HSPOX2
  • mitochondrial
  • p53-induced gene 6 protein
  • PIG6MGC148078
  • POX2
  • PRODH2MGC148079
  • proline dehydrogenase (oxidase) 1
  • proline dehydrogenase (proline oxidase )
  • Proline oxidase
  • proline oxidase, mitochondrial
  • SCZD4
  • tumor protein p53 inducible protein 6

Background

The protein encoded by this gene is a mitochondrial proline dehydrogenase that catalyzes the first step in proline degradation. Defects in this gene are a cause of hyperprolinemia type 1 and possibly susceptibility to schizophrenia 4 (SCZD4). The gene is located on chromosome 22q11.21, a region which has also been associated with the contiguous gene deletion syndromes DiGeorge syndrome and CATCH22 syndrome. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-46076
Species: Hu
Applications: WB, IHC
H00008659-D01P
Species: Hu, Mu
Applications: WB
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-20016
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00005498-M01
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-14264
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-85298
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PRODH Antibody (H00005625-M01) (0)

There are no publications for PRODH Antibody (H00005625-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRODH Antibody (H00005625-M01) (0)

There are no reviews for PRODH Antibody (H00005625-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRODH Antibody (H00005625-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRODH Products

Bioinformatics Tool for PRODH Antibody (H00005625-M01)

Discover related pathways, diseases and genes to PRODH Antibody (H00005625-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRODH Antibody (H00005625-M01)

Discover more about diseases related to PRODH Antibody (H00005625-M01).
 

Pathways for PRODH Antibody (H00005625-M01)

View related products by pathway.

PTMs for PRODH Antibody (H00005625-M01)

Learn more about PTMs related to PRODH Antibody (H00005625-M01).
 

Research Areas for PRODH Antibody (H00005625-M01)

Find related products by research area.

Blogs on PRODH

There are no specific blogs for PRODH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRODH Antibody (3A9) and receive a gift card or discount.

Bioinformatics

Gene Symbol PRODH
Entrez
Uniprot