PRKAG2 Antibody

Images

 
Western Blot: PRKAG2 Antibody [NBP1-89324] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunocytochemistry/ Immunofluorescence: PRKAG2 Antibody [NBP1-89324] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: PRKAG2 Antibody [NBP1-89324] - Staining of human rectum shows strong nuclear positivity in glandular cells.
Western Blot: PRKAG2 Antibody [NBP1-89324] - Analysis in human cell line A-431.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRKAG2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:STPTQVTKQHTFPLESYKHEPERLENRIYASSSPPDTGQRFCPSSFQSPTRPPLASPTHYAPSKAAALAAALGPAEAGMLEKLEFEDEAVEDSESGVYMRFMRSHK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRKAG2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PRKAG2 Protein (NBP1-89324PEP)
Publications
Read Publications using NBP1-89324.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRKAG2 Antibody

  • AAKG
  • AAKG2
  • CMH6AMPK subunit gamma-2
  • H91620pAMPK gamma2
  • protein kinase, AMP-activated, gamma 2 non-catalytic subunit
  • WPWS5'-AMP-activated protein kinase subunit gamma-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22217
Species: Hu, Mu, Rt(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB110-2546
Species: Hu, Mu, Rt, Po, Bv, Ca, Fe, Fi, Gt, Rb
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-52737
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF7439
Species: Hu
Applications: WB, IHC
NB200-412
Species: Hu, Mu, Rt, Ca
Applications: IA, S-ELISA
NBP2-37285
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-07799
Species: Hu
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6146
Species: Hu
Applications: ICC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-88068
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47863
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1908
Species: Hu, Mu, Rt, Po, Bv, Ch, Rb
Applications: WB, ELISA, ICC/IF, IHC, IP, MiAr
NBP2-42216
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF8064
Species: Hu
Applications: WB, IHC, ICC
NBP1-89324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PRKAG2 Antibody (NBP1-89324)(2)

Reviews for PRKAG2 Antibody (NBP1-89324) (0)

There are no reviews for PRKAG2 Antibody (NBP1-89324). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PRKAG2 Antibody (NBP1-89324) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRKAG2 Products

Bioinformatics Tool for PRKAG2 Antibody (NBP1-89324)

Discover related pathways, diseases and genes to PRKAG2 Antibody (NBP1-89324). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRKAG2 Antibody (NBP1-89324)

Discover more about diseases related to PRKAG2 Antibody (NBP1-89324).
 

Pathways for PRKAG2 Antibody (NBP1-89324)

View related products by pathway.

PTMs for PRKAG2 Antibody (NBP1-89324)

Learn more about PTMs related to PRKAG2 Antibody (NBP1-89324).
 

Research Areas for PRKAG2 Antibody (NBP1-89324)

Find related products by research area.

Blogs on PRKAG2

There are no specific blogs for PRKAG2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRKAG2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRKAG2