Novus Biologicals products are now on bio-techne.com

MyBPC3 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13632] - Analysis in human heart muscle and prostate tissues. Corresponding MyBPC3 RNA-seq data are presented for the same tissues.
Independent Antibodies: Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13632] - Staining of human endometrium, heart muscle, pancreas and prostate using Anti-MyBPC3 antibody NBP2-13632 (A) shows similar ...read more
Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13632] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.
Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13632] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13632] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13632] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MyBPC3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: TGDSDEWVFDKKLLCETEGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDA
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYBPC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 -1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MyBPC3 Protein (NBP2-13632PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MyBPC3 Antibody

  • Cardiac MyBP-C
  • CMH4
  • C-protein, cardiac muscle isoform
  • DKFZp779E1762
  • FHC
  • MYBP-C
  • MyBPC3
  • myosin binding protein C, cardiac
  • myosin-binding protein C, cardiac
  • myosin-binding protein C, cardiac-type

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB9096
Species: Hu
Applications: IHC, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
MAB4470
Species: All-Multi
Applications: ICC, IHC, WB
MAB1874
Species: Hu
Applications: ICC, IHC
NBP2-35336
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-88071
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-33716
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85541
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, WB
NBP1-97725
Species: Bv, Gt, Hu, Mu, Po, Rb, Rt, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-06985
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP1-88068
Species: Hu
Applications: IHC, IHC-P
NBP2-37958
Species: Hu
Applications: IHC, IHC-P
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NBP2-19807
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13632
Species: Hu, Mu, Rt
Applications: IHC

Publications for MyBPC3 Antibody (NBP2-13632) (0)

There are no publications for MyBPC3 Antibody (NBP2-13632).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MyBPC3 Antibody (NBP2-13632) (0)

There are no reviews for MyBPC3 Antibody (NBP2-13632). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MyBPC3 Antibody (NBP2-13632) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MyBPC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYBPC3