PRG-3 Antibody - BSA Free

Immunohistochemistry-Paraffin: PRG-3 Antibody [NBP1-87570] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PRG-3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PRG-3 Antibody - BSA Free (NBP1-87570) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KSTRESLIAQEKTILTGECCYLNPLLRRIIRF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LPPR1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PRG-3 Protein (NBP1-87570PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PRG-3 Antibody - BSA Free

• lipid phosphate phosphatase-related protein type 1
• MGC26189
• plasticity related gene 3
• Plasticity-related gene 3 protein
• PRG3
• PRG-3

Background

plasticity related gene 3 encodes a member of the plasticity-related gene (PRG) family. Members of the PRG family mediate lipid phosphate phosphatase activity in neurons and are known to be involved in neuronal plasticity. The protein encoded by this gene does not perform its function through enzymatic phospholipid degradation. This gene is strongly expressed in brain. It shows dynamic expression regulation during brain development and neuronal excitation. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LPPR1