EBP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: EBP Antibody [NBP1-85699] - Staining of human cell line U-251 MG shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: EBP Antibody [NBP1-85699] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EBP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YEDLLGDQAFLSQLWKEYAKGDSRYILGDNF
Specificity
Specificity of human EBP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EBP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control
EBP Knockout HeLa Cell Lysate
Control Peptide
EBP Protein (NBP1-85699PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for EBP Antibody

  • 3-beta-hydroxysteroid-Delta(8)
  • CDPX2
  • Cholestenol Delta-isomerase
  • CPX3-beta-hydroxysteroid-delta-8
  • CPXDX-linked dominant (Happle syndrome)
  • D8-D7 sterol isomerase
  • Delta(7)-isomerase
  • Delta(8)-Delta(7) sterol isomerase
  • delta-7-isomerase
  • EC 5.3.3.5
  • emopamil binding protein (sterol isomerase)
  • Emopamil-binding protein
  • sterol 8-isomerase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, ChIP, KD
NB100-56530
Species: Hu
Applications: WB
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67635
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP1-90364
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
DPSG10
Species: Hu
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO

Publications for EBP Antibody (NBP1-85699) (0)

There are no publications for EBP Antibody (NBP1-85699).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EBP Antibody (NBP1-85699) (0)

There are no reviews for EBP Antibody (NBP1-85699). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for EBP Antibody (NBP1-85699) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional EBP Products

Bioinformatics Tool for EBP Antibody (NBP1-85699)

Discover related pathways, diseases and genes to EBP Antibody (NBP1-85699). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EBP Antibody (NBP1-85699)

Discover more about diseases related to EBP Antibody (NBP1-85699).
 

Pathways for EBP Antibody (NBP1-85699)

View related products by pathway.

PTMs for EBP Antibody (NBP1-85699)

Learn more about PTMs related to EBP Antibody (NBP1-85699).

Blogs on EBP

There are no specific blogs for EBP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EBP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EBP