EBP Antibody


Immunocytochemistry/ Immunofluorescence: EBP Antibody [NBP1-85699] - Staining of human cell line U-251 MG shows localization to endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: EBP Antibody [NBP1-85699] - Staining of human testis shows strong granular cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: EBP Antibody [NBP1-85699] - Staining of human gastrointestinal shows weak granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: EBP Antibody [NBP1-85699] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: EBP Antibody [NBP1-85699] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

EBP Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: YEDLLGDQAFLSQLWKEYAKGDSRYILGDNF
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
EBP Protein (NBP1-85699PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for EBP Antibody

  • 3-beta-hydroxysteroid-Delta(8)
  • CDPX2
  • Cholestenol Delta-isomerase
  • CPX3-beta-hydroxysteroid-delta-8
  • CPXDX-linked dominant (Happle syndrome)
  • D8-D7 sterol isomerase
  • Delta(7)-isomerase
  • Delta(8)-Delta(7) sterol isomerase
  • delta-7-isomerase
  • EBP
  • EC
  • emopamil binding protein (sterol isomerase)
  • Emopamil-binding protein
  • sterol 8-isomerase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu
Applications: ELISA
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB

Publications for EBP Antibody (NBP1-85699) (0)

There are no publications for EBP Antibody (NBP1-85699).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EBP Antibody (NBP1-85699) (0)

There are no reviews for EBP Antibody (NBP1-85699). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for EBP Antibody (NBP1-85699) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional EBP Products

Bioinformatics Tool for EBP Antibody (NBP1-85699)

Discover related pathways, diseases and genes to EBP Antibody (NBP1-85699). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EBP Antibody (NBP1-85699)

Discover more about diseases related to EBP Antibody (NBP1-85699).

Pathways for EBP Antibody (NBP1-85699)

View related products by pathway.

PTMs for EBP Antibody (NBP1-85699)

Learn more about PTMs related to EBP Antibody (NBP1-85699).

Research Areas for EBP Antibody (NBP1-85699)

Find related products by research area.

Blogs on EBP

There are no specific blogs for EBP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our EBP Antibody and receive a gift card or discount.


Gene Symbol EBP