Presenilin-1 Antibody (3W4V8)

Western Blot: Presenilin-1 Antibody (3W4V8) [NBP3-15665] - Western blot analysis of extracts of various cell lines, using Presenilin-1 antibody (NBP3-15665) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clone: 3W4V8
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Presenilin-1 Antibody (3W4V8) Summary

• Description: Novus Biologicals Rabbit Presenilin-1 Antibody (3W4V8) (NBP3-15665) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Presenilin-1 (P49768). MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDNRERQEHNDRRSLGHPEPLSNGRPQGNSRQVVEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATI
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PSEN1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Presenilin-1 Antibody (3W4V8)

• AD3EC 3.4.23.-
• Alzheimer disease 3
• EC 3.4.23
• FAD
• presenilin 1
• Presenilin1
• Presenilin-1
• Protein S182
• PS-1
• PS1presenilin-1
• PSEN1
• PSNL1
• S182

Background

Presenilin (PS) facilitates gamma-secretase cleavage of the beta-amyloid precursor protein and the intramembraneous cleavage of Notch1 (1). Presenilin (PS) is essential for the gamma-cleavage required for the generation of the C terminus of amyloid beta-protein (Abeta). The discovery that a deficiency of presenilin 1 (PS1) decreases the production of amyloid beta-protein (Abeta) identified the presenilins as important mediators of the gamma-secretase cleavage of beta-amyloid precursor protein (APP). It has been shown that two conserved transmembrane (TM) aspartates in PS1 are critical for Abeta production, providing evidence that PS either functions as a required diaspartyl cofactor for gamma-secretase or is itself gamma-secretase. Presenilin 2 (PS2) shares substantial sequence and possibly functional homology with PS1. It has been shown that the two TM aspartates in PS2 are also critical for gamma-secretase activity, providing further evidence that PS2 is functionally homologous to PS1 (2). PS are found primarily within intracellular membranes, including the endoplasmic reticulum (ER) and the trans-Golgi network as well as the plasma membrane. PS are also expressed in most cell types throughout development (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PSEN1