PRDM5 Antibody - BSA Free

Western Blot: PRDM5 Antibody [NBP2-93069] - Analysis of extracts of various cell lines, using PRDM5 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 90s.

Immunocytochemistry/Immunofluorescence: PRDM5 Antibody [NBP2-93069] - Analysis of A549 cells using PRDM5 . Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: PRDM5 Antibody [NBP2-93069] - Paraffin-embedded rat spleen using PRDM5 .

Immunohistochemistry-Paraffin: PRDM5 Antibody [NBP2-93069] - Paraffin-embedded mouse liver using PRDM5 .

Immunohistochemistry-Paraffin: PRDM5 Antibody [NBP2-93069] - Paraffin-embedded mouse spleen using PRDM5 .

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PRDM5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PRDM5 Antibody - BSA Free (NBP2-93069) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human PRDM5 (NP_061169.2). MLGMYVPDRFSLKSSRVQDGMGLYTARRVRKGEKFGPFAGEKRMPEDLDENMDYRLMWEVRGSKGEVLYILDATNPRHSNWLRFVHEAPSQEQKNLAAIQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRDM5
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PRDM5 Antibody - BSA Free

• PFM2PR domain-containing protein 5
• PR domain containing 5
• PR domain zinc finger protein 5

Background

Official Gene Symbol PRDM5 Gene ID 11107(Human) Gene Map Locus 4q25-q26(Human) PRDM5, a novel member of PR domain protein family, contains a PR-domain at the NH2 terminus followed by 16 zinc finger motifs. It is found to have a role in cell differentiation and tumorigenesis. Reports suggest PRDM5 causes G2/M arrest and apoptosis upon infection of tumor cells and has been found to be silenced in breast, ovarian and lung cancers, suggesting a potential clinical significance.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRDM5