PRDM5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PRDM5 Antibody [NBP2-13810] - Staining of human cell line RH-30 shows localization to nucleus, nucleoli & nuclear bodies.
Immunohistochemistry-Paraffin: PRDM5 Antibody [NBP2-13810] - Staining of human colon shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRDM5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GDARFVCKADSCGKRLKSKDALKRHQENVHTGDPKKKLICSVCNKKCSSA SSLQEHRKIHEIFDCQECMKK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRDM5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PRDM5 Protein (NBP2-13810PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRDM5 Antibody

  • PFM2PR domain-containing protein 5
  • PR domain containing 5
  • PR domain zinc finger protein 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89644
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88677
Species: Hu
Applications: WB, IHC, IHC-P
NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-07799
Species: Hu
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15142
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57200
Species: Hu
Applications: ICC/IF
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-45490
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57206
Species: Hu
Applications: ICC/IF
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP2-19926
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13810
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for PRDM5 Antibody (NBP2-13810) (0)

There are no publications for PRDM5 Antibody (NBP2-13810).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRDM5 Antibody (NBP2-13810) (0)

There are no reviews for PRDM5 Antibody (NBP2-13810). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PRDM5 Antibody (NBP2-13810) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRDM5 Products

Bioinformatics Tool for PRDM5 Antibody (NBP2-13810)

Discover related pathways, diseases and genes to PRDM5 Antibody (NBP2-13810). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRDM5 Antibody (NBP2-13810)

Discover more about diseases related to PRDM5 Antibody (NBP2-13810).
 

Pathways for PRDM5 Antibody (NBP2-13810)

View related products by pathway.

PTMs for PRDM5 Antibody (NBP2-13810)

Learn more about PTMs related to PRDM5 Antibody (NBP2-13810).
 

Research Areas for PRDM5 Antibody (NBP2-13810)

Find related products by research area.

Blogs on PRDM5

There are no specific blogs for PRDM5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRDM5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRDM5