PRDM4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PRDM4 Antibody [NBP2-55794] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRDM4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FCTSQDIPPENELLFYYSRDYAQQIGVPEHPDVHLCNCGKECNSYTEFKAHLTSHIHNHLPTQGHSGSHGPSHSKERKWKCSMC
Specificity
Specificity of human PRDM4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRDM4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PRDM4 Antibody

  • MGC45046
  • PFM1PR domain-containing protein 4
  • PR domain containing 4
  • PR domain zinc finger protein 4
  • PR-domain zinc-finger protein PFM1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89644
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5945
Species: Hu, Mu, Rt
Applications: WB
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
H00005555-P01
Species: Hu
NB100-56641
Species: Hu, Mu
Applications: WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-52540
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, CyTOF-ready
MAB197
Species: Hu
Applications: Flow, IHC, CyTOF-reported, ICC, Neut
AF2728
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
H00006941-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-43233
Species: Mu
Applications: Flow, IHC, IHC-P
H00008294-P01
Species: Hu
AF3764
Species: Hu, Mu
Applications: WB, IHC, ICC
NB21-2024
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF

Publications for PRDM4 Antibody (NBP2-55794) (0)

There are no publications for PRDM4 Antibody (NBP2-55794).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRDM4 Antibody (NBP2-55794) (0)

There are no reviews for PRDM4 Antibody (NBP2-55794). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PRDM4 Antibody (NBP2-55794) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PRDM4 Products

Bioinformatics Tool for PRDM4 Antibody (NBP2-55794)

Discover related pathways, diseases and genes to PRDM4 Antibody (NBP2-55794). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRDM4 Antibody (NBP2-55794)

Discover more about diseases related to PRDM4 Antibody (NBP2-55794).
 

Pathways for PRDM4 Antibody (NBP2-55794)

View related products by pathway.

PTMs for PRDM4 Antibody (NBP2-55794)

Learn more about PTMs related to PRDM4 Antibody (NBP2-55794).
 

Research Areas for PRDM4 Antibody (NBP2-55794)

Find related products by research area.

Blogs on PRDM4

There are no specific blogs for PRDM4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRDM4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRDM4