PRAM1 Antibody

Images

 
Western Blot: PRAM1 Antibody [NBP2-13809] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: PRAM1 Antibody [NBP2-13809] - Staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PRAM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TDLPKKPSKLELSDLSKKFPQLGATPFPRKPLQPEVGEAPLKASLPEPGA PARKPLQPDELSHPARPPSEPKSGAFPRKLWQP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PRAM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PRAM1 Protein (NBP2-13809PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PRAM1 Antibody

  • MGC39864
  • PML-RAR
  • PML-RARA regulated adaptor molecule 1
  • PML-RARA target gene encoding an Adaptor Molecule-1
  • PML-RARA-regulated adapter molecule 1
  • PRAM
  • PRAM-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP1-58922
Species: Hu
Applications: WB
NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF2944
Species: Hu
Applications: WB, Simple Western
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
AF5414
Species: Hu
Applications: WB, Simple Western
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-2781
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-Fr
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-49154
Species: Hu
Applications: IHC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-89105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB3857
Species: Hu
Applications: WB
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP2-13809
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PRAM1 Antibody (NBP2-13809) (0)

There are no publications for PRAM1 Antibody (NBP2-13809).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRAM1 Antibody (NBP2-13809) (0)

There are no reviews for PRAM1 Antibody (NBP2-13809). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PRAM1 Antibody (NBP2-13809) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PRAM1 Products

Bioinformatics Tool for PRAM1 Antibody (NBP2-13809)

Discover related pathways, diseases and genes to PRAM1 Antibody (NBP2-13809). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PRAM1 Antibody (NBP2-13809)

Discover more about diseases related to PRAM1 Antibody (NBP2-13809).
 

Pathways for PRAM1 Antibody (NBP2-13809)

View related products by pathway.

PTMs for PRAM1 Antibody (NBP2-13809)

Learn more about PTMs related to PRAM1 Antibody (NBP2-13809).

Blogs on PRAM1

There are no specific blogs for PRAM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PRAM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PRAM1