PR48 Antibody [DyLight 650]

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: DyLight 650

PR48 Antibody [DyLight 650] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 356-575 of human PR48 (NP_037371.2).
  
  Sequence:
  FSGAVTRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPP2R3B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for PR48 Antibody [DyLight 650]

• FLJ60425
• NY-REN-8 antigen
• NYREN8
• PP2A subunit B isoform PR48
• PP2A, subunit B, PR48 isoform
• PPP2R3L
• PPP2R3LY
• PR48
• protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta
• protein phosphatase 2, regulatory subunit B'', beta
• Protein phosphatase 2A 48 kDa regulatory subunit
• serine/threonine protein phosphatase 2A, 48kDa regulatory subunit B
• serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta

Background

PP2A is a major serine/threonine phosphatase that is implicated in the negative control of cell cycle progression. It is a trimeric holoenzyme that is comprised of a catalytic, structural, and regulatory subunit. PPP2R3B is a regulatory subunit of PP2A. The regulatory subunits of PP2A are grouped into 3 families: B/PR55, B'/PR61, and B''/PR72. PPP2R3B encodes a 48 kDa B'' regulatory subunit. PPP2R3B and PP2A, in association with Cdc6, are implicated in cell cycle control via phosphatase activity targeted at DNA replication machinery.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP2R3B