PR48 Antibody - BSA Free

Western Blot: PR48 Antibody [NBP3-38554] - Western blot analysis of various lysates using PR48 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 30s.

Western Blot: PR48 Antibody [NBP3-38554] - Western blot analysis of lysates from mouse skeletal muscle, using PR48 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PR48 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PR48 Antibody - BSA Free (NBP3-38554) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 356-575 of human PR48 (NP_037371.2).
  
  Sequence:
  FSGAVTRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPP2R3B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 65 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PR48 Antibody - BSA Free

• FLJ60425
• NY-REN-8 antigen
• NYREN8
• PP2A subunit B isoform PR48
• PP2A, subunit B, PR48 isoform
• PPP2R3L
• PPP2R3LY
• PR48
• protein phosphatase 2 (formerly 2A), regulatory subunit B'', beta
• protein phosphatase 2, regulatory subunit B'', beta
• Protein phosphatase 2A 48 kDa regulatory subunit
• serine/threonine protein phosphatase 2A, 48kDa regulatory subunit B
• serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta

Background

PP2A is a major serine/threonine phosphatase that is implicated in the negative control of cell cycle progression. It is a trimeric holoenzyme that is comprised of a catalytic, structural, and regulatory subunit. PPP2R3B is a regulatory subunit of PP2A. The regulatory subunits of PP2A are grouped into 3 families: B/PR55, B'/PR61, and B''/PR72. PPP2R3B encodes a 48 kDa B'' regulatory subunit. PPP2R3B and PP2A, in association with Cdc6, are implicated in cell cycle control via phosphatase activity targeted at DNA replication machinery.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP2R3B