PPP3CB Antibody


Western Blot: PPP3CB Antibody [NBP2-58920] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: PPP3CB Antibody [NBP2-58920] - Staining of human cell line U-251 MG shows localization to mitochondria.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF

Order Details

PPP3CB Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITV
Specificity of human PPP3CB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (91%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for PPP3CB Antibody

  • Calmodulin-dependent calcineurin A subunit beta isoform
  • CALNA2protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform(calcineurin A beta)
  • CAM-PRP catalytic subunit
  • CNA2catalytic subunit, beta isoform
  • EC
  • protein phosphatase 2B, catalytic subunit, beta isoform
  • protein phosphatase 3, catalytic subunit, beta isozyme
  • protein phosphatase from PCR fragment H32
  • serine/threonine-protein phosphatase 2B catalytic subunit beta isoform


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Av, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
Species: Hu
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for PPP3CB Antibody (NBP2-58920) (0)

There are no publications for PPP3CB Antibody (NBP2-58920).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP3CB Antibody (NBP2-58920) (0)

There are no reviews for PPP3CB Antibody (NBP2-58920). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PPP3CB Antibody (NBP2-58920) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for PPP3CB Antibody (NBP2-58920)

Discover related pathways, diseases and genes to PPP3CB Antibody (NBP2-58920). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP3CB Antibody (NBP2-58920)

Discover more about diseases related to PPP3CB Antibody (NBP2-58920).

Pathways for PPP3CB Antibody (NBP2-58920)

View related products by pathway.

PTMs for PPP3CB Antibody (NBP2-58920)

Learn more about PTMs related to PPP3CB Antibody (NBP2-58920).

Research Areas for PPP3CB Antibody (NBP2-58920)

Find related products by research area.

Blogs on PPP3CB

There are no specific blogs for PPP3CB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PPP3CB Antibody and receive a gift card or discount.


Gene Symbol PPP3CB