PPP3CC Antibody

Images

 
Western Blot: PPP3CC Antibody [NBP1-86656] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: PPP3CC Antibody [NBP1-86656] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: PPP3CC Antibody [NBP1-86656] - Staining of human testis shows distinct membranous positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPP3CC Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RGFSLQHKIRSFEEARGLDRINERMPPRKDSIHAGGPMKSVTSAHSHAAHRSDQGKKAHS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP3CC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PPP3CC Protein (NBP1-86656PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPP3CC Antibody

  • Calcineurin, testis-specific catalytic subunit
  • Calmodulin-dependent calcineurin A subunit gamma isoform
  • CALNA3CAM-PRP catalytic subunit
  • CNA3
  • EC 3.1.3.16
  • PP2Bgamma
  • protein phosphatase 2B, catalytic subunit, gamma isoform
  • protein phosphatase 3 (formerly 2B), catalytic subunit, gamma isoform
  • protein phosphatase 3 (formerly 2B), catalytic subunit, gamma isoform(calcineurin A gamma)
  • protein phosphatase 3, catalytic subunit, gamma isozyme
  • serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80903
Species: Hu
Applications: IHC, IHC-P
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85298
Species: Hu
Applications: WB, IHC, IHC-P
AF1348
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP1-33041
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32567
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-14264
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00005535-T01
Species: Hu
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
H00006532-M06
Species: Hu
Applications: ELISA, IP
NBP1-79948
Species: Hu, Rt
Applications: WB
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready

Publications for PPP3CC Antibody (NBP1-86656) (0)

There are no publications for PPP3CC Antibody (NBP1-86656).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP3CC Antibody (NBP1-86656) (0)

There are no reviews for PPP3CC Antibody (NBP1-86656). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PPP3CC Antibody (NBP1-86656) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPP3CC Products

Bioinformatics Tool for PPP3CC Antibody (NBP1-86656)

Discover related pathways, diseases and genes to PPP3CC Antibody (NBP1-86656). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP3CC Antibody (NBP1-86656)

Discover more about diseases related to PPP3CC Antibody (NBP1-86656).
 

Pathways for PPP3CC Antibody (NBP1-86656)

View related products by pathway.

PTMs for PPP3CC Antibody (NBP1-86656)

Learn more about PTMs related to PPP3CC Antibody (NBP1-86656).

Blogs on PPP3CC

There are no specific blogs for PPP3CC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPP3CC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP3CC