PPP3CB Antibody


Western Blot: PPP3CB Antibody [NBP1-74253] - Mouse Heart Lysate 1ug/ml Gel Concentration 12%

Product Details

Reactivity MuSpecies Glossary
Applications WB

Order Details

PPP3CB Antibody Summary

Synthetic peptides corresponding to the C terminal of Ppp3cb. Immunizing peptide sequence ESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRI.
This product is specific to Subunit or Isoform: beta isoform.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Ppp3cb and was validated on Western blot.
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PPP3CB Antibody

  • Calmodulin-dependent calcineurin A subunit beta isoform
  • CALNA2protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform(calcineurin A beta)
  • CAM-PRP catalytic subunit
  • CNA2catalytic subunit, beta isoform
  • EC
  • protein phosphatase 2B, catalytic subunit, beta isoform
  • protein phosphatase 3, catalytic subunit, beta isozyme
  • protein phosphatase from PCR fragment H32
  • serine/threonine-protein phosphatase 2B catalytic subunit beta isoform


Ppp3cb is a Calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Av, Ce
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
Species: Hu
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
Species: Mu
Applications: WB

Publications for PPP3CB Antibody (NBP1-74253) (0)

There are no publications for PPP3CB Antibody (NBP1-74253).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP3CB Antibody (NBP1-74253) (0)

There are no reviews for PPP3CB Antibody (NBP1-74253). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPP3CB Antibody (NBP1-74253) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional PPP3CB Products

Bioinformatics Tool for PPP3CB Antibody (NBP1-74253)

Discover related pathways, diseases and genes to PPP3CB Antibody (NBP1-74253). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP3CB Antibody (NBP1-74253)

Discover more about diseases related to PPP3CB Antibody (NBP1-74253).

Pathways for PPP3CB Antibody (NBP1-74253)

View related products by pathway.

PTMs for PPP3CB Antibody (NBP1-74253)

Learn more about PTMs related to PPP3CB Antibody (NBP1-74253).

Blogs on PPP3CB

There are no specific blogs for PPP3CB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PPP3CB Antibody and receive a gift card or discount.


Gene Symbol PPP3CB