PPP3CB Antibody

Images

 
Western Blot: PPP3CB Antibody [NBP1-74253] - Mouse Heart Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPP3CB Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of Ppp3cb. Immunizing peptide sequence ESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRI.
Specificity
This product is specific to Subunit or Isofrom: beta isoform.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP3CB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Ppp3cb and was validated on Western blot.
Theoretical MW
58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PPP3CB Antibody

  • Calmodulin-dependent calcineurin A subunit beta isoform
  • CALNA2protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform(calcineurin A beta)
  • CAM-PRP catalytic subunit
  • CNA2catalytic subunit, beta isoform
  • EC 3.1.3.16
  • protein phosphatase 2B, catalytic subunit, beta isoform
  • protein phosphatase 3, catalytic subunit, beta isozyme
  • protein phosphatase from PCR fragment H32
  • serine/threonine-protein phosphatase 2B catalytic subunit beta isoform

Background

Ppp3cb is a Calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33041
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1348
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-84425
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
H00009446-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-86656
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB100-56732
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF
H00005535-T01
Species: Hu
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-74253
Species: Mu
Applications: WB

Publications for PPP3CB Antibody (NBP1-74253) (0)

There are no publications for PPP3CB Antibody (NBP1-74253).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP3CB Antibody (NBP1-74253) (0)

There are no reviews for PPP3CB Antibody (NBP1-74253). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPP3CB Antibody (NBP1-74253) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPP3CB Products

Bioinformatics Tool for PPP3CB Antibody (NBP1-74253)

Discover related pathways, diseases and genes to PPP3CB Antibody (NBP1-74253). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP3CB Antibody (NBP1-74253)

Discover more about diseases related to PPP3CB Antibody (NBP1-74253).
 

Pathways for PPP3CB Antibody (NBP1-74253)

View related products by pathway.

PTMs for PPP3CB Antibody (NBP1-74253)

Learn more about PTMs related to PPP3CB Antibody (NBP1-74253).

Blogs on PPP3CB

There are no specific blogs for PPP3CB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPP3CB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP3CB
Uniprot