TEL2 Antibody

Images

 
Western Blot: TEL2 Antibody [NBP1-81761] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: TEL2 Antibody [NBP1-81761] - Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear bodies & cytosol.
Immunohistochemistry-Paraffin: TEL2 Antibody [NBP1-81761] - Staining of human urinary bladder shows cytoplasmic and nuclear positivity in urothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TEL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SKAVLICLAQLGEPELRDSRDELLASMMAGVKCRLDSSLPPVRRLGMIVAEVVSARIHPEGPPLKFQYEEDELSLELLALASPQPAGDGASEAGTSLVPATA
Specificity
Specificity of human TEL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TELO2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TEL2 Protein (NBP1-81761PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TEL2 Antibody

  • CLK2
  • DKFZp434A073
  • EC 1.1.1.27
  • EC 2.7.11.1
  • hCLK2
  • KIAA0683FLJ10924
  • Protein clk-2 homolog
  • TEL2
  • TEL2, telomere maintenance 2, homolog (S. cerevisiae)
  • telomere length regulation protein TEL2 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-308
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00001195-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-80694
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7365
Species: Hu, Mu, Rt
Applications: WB
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-79034
Species: Hu
Applications: WB, IP
NBP2-39084
Species: Hu
Applications: IHC, IHC-P
NBP2-22128
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-2320
Species: Hu
Applications: IP (-), WB, IP
NBP1-81120
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-66861
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-40354
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-86165
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5344
Species: Hu, Mu
Applications: WB

Publications for TEL2 Antibody (NBP1-81761) (0)

There are no publications for TEL2 Antibody (NBP1-81761).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TEL2 Antibody (NBP1-81761) (0)

There are no reviews for TEL2 Antibody (NBP1-81761). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TEL2 Antibody (NBP1-81761) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TEL2 Antibody (NBP1-81761)

Discover related pathways, diseases and genes to TEL2 Antibody (NBP1-81761). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TEL2 Antibody (NBP1-81761)

View related products by pathway.

Blogs on TEL2

There are no specific blogs for TEL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TEL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TELO2