PPP1R3C Antibody

Images

 
Western Blot: PPP1R3C Antibody [NBP1-87236] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-442
Immunohistochemistry-Paraffin: PPP1R3C Antibody [NBP1-87236] - Staining of human heart muscle shows cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PPP1R3C Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PRPLTSSVMPVDVAMRLCLAHSPPVKSFLGPYDEFQRRHFVNKLKPLKSCLNIKHKAKSQNDWKCSHNQAKKRVVFADSKGLSLTAIHVFSDLPEEPAWDLQFDLLDL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP1R3C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PPP1R3C Protein (NBP1-87236PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPP1R3C Antibody

  • Phosphatase 1, regulatory inhibitor subunit 5
  • PPP1R5PP1 subunit R5
  • protein phosphatase 1 regulatory subunit 3C
  • Protein phosphatase 1 regulatory subunit 5
  • protein phosphatase 1, regulatory (inhibitor) subunit 3C
  • Protein targeting to glycogen
  • PTG

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-35213
Species: Hu
NBP2-42173
Species: Hu
Applications: WB, ICC/IF, ICC
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS1071
Species: Hu
Applications: IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00007957-M02
Species: Hu, Rt
Applications: WB, ELISA
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
NBP1-82243
Species: Hu
Applications: WB, IHC, IHC-P
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IF
NBP1-59934
Species: Hu
Applications: WB
NBP1-81829
Species: Hu
Applications: WB, IHC, IHC-P
NB110-60930
Species: Hu, Mu
Applications: WB
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-85789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87236
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PPP1R3C Antibody (NBP1-87236) (0)

There are no publications for PPP1R3C Antibody (NBP1-87236).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP1R3C Antibody (NBP1-87236) (0)

There are no reviews for PPP1R3C Antibody (NBP1-87236). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPP1R3C Antibody (NBP1-87236) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPP1R3C Products

Bioinformatics Tool for PPP1R3C Antibody (NBP1-87236)

Discover related pathways, diseases and genes to PPP1R3C Antibody (NBP1-87236). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPP1R3C Antibody (NBP1-87236)

Discover more about diseases related to PPP1R3C Antibody (NBP1-87236).
 

Pathways for PPP1R3C Antibody (NBP1-87236)

View related products by pathway.

PTMs for PPP1R3C Antibody (NBP1-87236)

Learn more about PTMs related to PPP1R3C Antibody (NBP1-87236).

Blogs on PPP1R3C

There are no specific blogs for PPP1R3C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPP1R3C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1R3C