PPP1R3C Antibody - BSA Free

Western Blot: PPP1R3C Antibody [NBP1-87236] - Analysis in human cell line RT-4.

Immunohistochemistry-Paraffin: PPP1R3C Antibody [NBP1-87236] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: PPP1R3C Antibody [NBP1-87236] - Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.

Immunohistochemistry-Paraffin: PPP1R3C Antibody [NBP1-87236] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: PPP1R3C Antibody [NBP1-87236] - Staining of human lung shows strong cytoplasmic positivity in macrophages.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PPP1R3C Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PPP1R3C Antibody - BSA Free (NBP1-87236) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PRPLTSSVMPVDVAMRLCLAHSPPVKSFLGPYDEFQRRHFVNKLKPLKSCLNIKHKAKSQNDWKCSHNQAKKRVVFADSKGLSLTAIHVFSDLPEEPAWDLQFDLLDL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPP1R3C
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PPP1R3C Protein (NBP1-87236PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (84%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PPP1R3C Antibody - BSA Free

• Phosphatase 1, regulatory inhibitor subunit 5
• PPP1R5PP1 subunit R5
• protein phosphatase 1 regulatory subunit 3C
• Protein phosphatase 1 regulatory subunit 5
• protein phosphatase 1, regulatory (inhibitor) subunit 3C
• Protein targeting to glycogen
• PTG

Background

Protein phosphatase-1 (PP1; see MIM 176875) participates in the regulation of a wide variety of cellular functions by reversible protein phosphorylation. The ability of PP1 to regulate diverse functions resides in its capacity to interact with a variety of regulatory subunits that may target PP1 to specific subcellular locations, modulate its substrate specificity, and allow its activity to be responsive to extracellular signals. Several targeting subunits of PP1 have been identified, including PPP1R5, the glycogen-binding subunits PPP1R3 (MIM 600917) and PPP1R4, and the nuclear inhibitor of PP1 (PPP1R8; MIM 602636).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPP1R3C