PPM1D Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PPM1D Antibody [NBP1-87249] - Staining of human cell line A-431 shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: PPM1D Antibody [NBP1-87249] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: PPM1D Antibody [NBP1-87249] - Staining of human liver shows moderate to strong nuclear positivity in hepatocytes.

Immunohistochemistry-Paraffin: PPM1D Antibody [NBP1-87249] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.

Immunohistochemistry-Paraffin: PPM1D Antibody [NBP1-87249] - Staining of human cerebellum shows moderate to strong nuclear positivity in cells in white matter.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PPM1D Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PPM1D Antibody - BSA Free (NBP1-87249) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KHKYIILGSDGLWNMIPPQDAISMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQRMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLT
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPM1D
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PPM1D Protein (NBP1-87249PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PPM1D Antibody - BSA Free

• EC 3.1.3.16
• p53-induced protein phosphatase 1
• PP2C-delta
• PPM1D
• protein phosphatase 1D magnesium-dependent, delta isoform
• protein phosphatase 1D
• protein phosphatase 2C delta isoform
• Protein phosphatase 2C isoform delta
• Protein phosphatase magnesium-dependent 1 delta
• protein phosphatase, Mg2+/Mn2+ dependent, 1D
• wild-type p53-induced phosphatase 1
• Wip1
• WIP1protein phosphatase Wip1

Background

PPM1D is encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. The expression of this gene is induced in a p53-dependent manner in response to various environmental stresses. While being induced by tumor suppressor protein TP53/p53, this phosphatase negatively regulates the activity of p38 MAP kinase, MAPK/p38, through which it reduces the phosphorylation of p53, and in turn suppresses p53-mediated transcription and apoptosis. This phosphatase thus mediates a feedback regulation of p38-p53 signaling that contributes to growth inhibition and the suppression of stress induced apoptosis. This gene is located in a chromosomal region known to be amplified in breast cancer. The amplification of this gene has been detected in both breast cancer cell line and primary breast tumors, which suggests a role of this gene in cancer development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPM1D