PPFIBP2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: PPFIBP2 Antibody [NBP1-86575] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.

Immunohistochemistry-Paraffin: PPFIBP2 Antibody [NBP1-86575] - Analysis in human parathyroid gland and skeletal muscle tissues using NBP1-86575 antibody. Corresponding PPFIBP2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: PPFIBP2 Antibody [NBP1-86575] - Staining of human prostate, skeletal muscle, skin and stomach using Anti-PPFIBP2 antibody NBP1-86575 (A) shows similar protein distribution across tissues to independent antibody NBP1-86576 (B).

Immunohistochemistry-Paraffin: PPFIBP2 Antibody [NBP1-86575] - Staining of human prostate shows weak cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: PPFIBP2 Antibody [NBP1-86575] - Staining of human parathyroid gland shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: PPFIBP2 Antibody [NBP1-86575] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: PPFIBP2 Antibody [NBP1-86575] - Staining of human skin shows weak cytoplasmic positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: PPFIBP2 Antibody [NBP1-86575] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PPFIBP2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SGATPNGEAAKSPPTICQPDATGSSLLRLRDTESGWDDTAVVNDLSSTSSGTESGPQSPLTPDGKRNPKGIKKFWGKIRRTQSGNFYTDTLGMAEFRRGGL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PPFIBP2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  PPFIBP2 Protein (NBP1-86575PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PPFIBP2 Antibody - BSA Free

• Cclp1
• DKFZp781K06126
• liprin-beta-2
• MGC42541
• Protein tyrosine phosphatase receptor type f polypeptide-interactingprotein-binding protein 2
• PTPRF interacting protein, binding protein 2 (liprin beta 2)
• PTPRF-interacting protein-binding protein 2

Background

PPFIBP2, or liprin-beta-2, belongs to the liprin-beta family. See liprin-beta-1 (MIM 603141) for background on liprins.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PPFIBP2