Cingulin Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Cingulin Antibody [NBP1-89600] - Staining in human small intestine and lymph node tissues using anti-CGN antibody. Corresponding CGN RNA-seq data are ...read more
Independent Antibodies: Western Blot: Cingulin Antibody [NBP1-89600] - Analysis using Anti-CGN antibody NBP1-89600 (A) shows similar pattern to independent antibody NBP1-89602 (B).
Western Blot: Cingulin Antibody [NBP1-89600] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Orthogonal Strategies: Western Blot: Cingulin Antibody [NBP1-89600] - Analysis in human cell lines Caco-2 and HeLa using Anti-CGN antibody. Corresponding CGN RNA-seq data are presented for the same cell lines. ...read more
Immunohistochemistry-Paraffin: Cingulin Antibody [NBP1-89600] - Staining of human lymph node shows low expression as expected.
Immunohistochemistry-Paraffin: Cingulin Antibody [NBP1-89600] - Staining of human small intestine shows high expression.

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cingulin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DSKQALQQLQAQLEDYKEKARREVADAQRQAKDWASEAEKTSGGLSRLQDEIQRLRQALQASQAERDTARLDKELLAQRLQGLEQEAENKKRSQDDRARQLKGLEE
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CGN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunohistochemistry-Frozen reported in scientific literature (PMID: 31719823).
Control Peptide
Cingulin Protein (NBP1-89600PEP)
Publications
Read Publication using
NBP1-89600 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cingulin Antibody

  • cingulin
  • DKFZp779N1112
  • KIAA1319

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-87402
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP1-87402
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
NBP2-38696
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
H00009076-M01
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
9134-TN
Species: Hu
Applications: BA
H00001392-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-66784
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB208
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
AF1638
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB

Publications for Cingulin Antibody (NBP1-89600)(1)

We have publications tested in 1 confirmed species: Rat.

We have publications tested in 1 application: IHC-Fr.


Filter By Application
IHC-Fr
(1)
All Applications
Filter By Species
Rat
(1)
All Species

Reviews for Cingulin Antibody (NBP1-89600) (0)

There are no reviews for Cingulin Antibody (NBP1-89600). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cingulin Antibody (NBP1-89600) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cingulin Products

Bioinformatics Tool for Cingulin Antibody (NBP1-89600)

Discover related pathways, diseases and genes to Cingulin Antibody (NBP1-89600). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cingulin Antibody (NBP1-89600)

Discover more about diseases related to Cingulin Antibody (NBP1-89600).
 

Pathways for Cingulin Antibody (NBP1-89600)

View related products by pathway.

PTMs for Cingulin Antibody (NBP1-89600)

Learn more about PTMs related to Cingulin Antibody (NBP1-89600).
 

Research Areas for Cingulin Antibody (NBP1-89600)

Find related products by research area.

Blogs on Cingulin

There are no specific blogs for Cingulin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cingulin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CGN