PPAR gamma/NR1C3 Recombinant Protein Antigen

Images

 
There are currently no images for PPAR gamma/NR1C3 Recombinant Protein Antigen (NBP2-56194PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PPAR gamma/NR1C3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPAR gamma/NR1C3.

Source: E. coli

Amino Acid Sequence: SYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPARG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56194.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PPAR gamma/NR1C3 Recombinant Protein Antigen

  • CIMT1
  • NR1C3
  • NR1C3GLM1
  • Nuclear receptor subfamily 1 group C member 3
  • peroxisome proliferator-activated receptor gamma 1
  • peroxisome proliferator-activated receptor gamma
  • PPAR gamma
  • PPARG
  • PPARG1peroxisome proliferative activated receptor, gamma
  • PPARG2PPARgamma
  • PPAR-gamma

Background

PPAR gamma(PPARG), which encodes a member of the peroxisome proliferator-activated receptor (PPAR) subfamily of nuclear receptors. Three subtypes of PPARs are known: PPAR-alpha, PPAR-delta, and PPAR-gamma. The protein encoded by this gene is PPAR-gamma and is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. Alternatively spliced transcript variants that encode different isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-636
Species: Ca, Hu, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
DRP300
Species: Hu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
DLP00
Species: Hu
Applications: ELISA
AF7197
Species: Hu, Mu
Applications: ICC, IHC, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
AF1443
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB400-144
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP1-04676
Species: Gt, Ha, Hu, Mu, Po, Rt, Sh, Sq
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, Simple Western, WB
DCP00
Species: Hu
Applications: ELISA
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, KD, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB

Publications for PPAR gamma/NR1C3 Recombinant Protein Antigen (NBP2-56194PEP) (0)

There are no publications for PPAR gamma/NR1C3 Recombinant Protein Antigen (NBP2-56194PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPAR gamma/NR1C3 Recombinant Protein Antigen (NBP2-56194PEP) (0)

There are no reviews for PPAR gamma/NR1C3 Recombinant Protein Antigen (NBP2-56194PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PPAR gamma/NR1C3 Recombinant Protein Antigen (NBP2-56194PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPAR gamma/NR1C3 Products

Research Areas for PPAR gamma/NR1C3 Recombinant Protein Antigen (NBP2-56194PEP)

Find related products by research area.

Blogs on PPAR gamma/NR1C3.

PPAR gamma - An important target in human metabolism
Peroxisome proliferators are non-genotoxic carcinogens which are purported to exert their effect on cells by interacting with members of the nuclear hormone receptor superfamily known as peroxisome proliferator activated receptors (PPARs). There are f...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PPAR gamma/NR1C3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PPARG