POT1 Recombinant Protein Antigen

Images

 
There are currently no images for POT1 Recombinant Protein Antigen (NBP2-57891PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

POT1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human POT1.

Source: E. coli

Amino Acid Sequence: LTFEGTLGAPIIPRTSSKYFNFTTEDHKMVEALRVWASTHMSPSWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASFLLKVWDGTR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
POT1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57891.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for POT1 Recombinant Protein Antigen

  • DKFZp586D211
  • HPOT1
  • POT1 protection of telomeres 1 homolog
  • POT1
  • POT1-like telomere end-binding protein
  • protection of telomeres 1 homolog (S. pombe)
  • protection of telomeres protein 1

Background

POT1 (protection of telomeres 1), a telomere regulator, is a single-stranded telomeric DNA-binding protein that controls telomerase-mediated telomere elongation. Telomere maintenance is required for protection against changes in telomere length, which has been implicated in ageing and certain cancers. Specifically, this protein functions as a member of a multi-protein complex that binds to the TTAGGG repeats of telomeres, regulating telomere length and protecting chromosome ends from illegitimate recombination, catastrophic chromosome instability, and abnormal chromosome segregation. Excessive transcriptional expression of POT1 has been associated with stomach cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-57130
Species: ChHa, Hu, Mu, Pm, Rt
Applications: ChIP, DB, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
H00065057-M02
Species: Hu
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NB110-68281
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, Simple Western, WB
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-85561
Species: Hu
Applications: IHC,  IHC-P
NBP2-55709
Species: Hu
Applications: ICC/IF, WB
NBP2-14870
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-292
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB100-317
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-49938
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
AF3767
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-03417
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NB100-308
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
NB100-56585
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-104
Species: Ca, Hu, Ma, Mu, Rt
Applications: ELISA, Flow, IB, ICC/IF, IHC,  IHC-P, IP, WB
AF7116
Species: Hu
Applications: WB
NB100-471
Species: Hu
Applications: ChIP, ICC/IF, IHC, IP, Simple Western, WB
NBP2-57891PEP
Species: Hu
Applications: AC

Publications for POT1 Recombinant Protein Antigen (NBP2-57891PEP) (0)

There are no publications for POT1 Recombinant Protein Antigen (NBP2-57891PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POT1 Recombinant Protein Antigen (NBP2-57891PEP) (0)

There are no reviews for POT1 Recombinant Protein Antigen (NBP2-57891PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for POT1 Recombinant Protein Antigen (NBP2-57891PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional POT1 Products

Research Areas for POT1 Recombinant Protein Antigen (NBP2-57891PEP)

Find related products by research area.

Blogs on POT1.

Application Highlight: Recent uses of TERF2 in immunofluorescence (IF)
Telomeres are a region of repeat nucleotide sequences located at the end of chromosomes to protect our DNA from becoming damaged via end-to-end fusion.  TERF2, or telomeric-repeat binding factor 2, is important for telomere integrity and aids in th...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our POT1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol POT1