POPDC3 Antibody - BSA Free

Western Blot: POPDC3 Antibody [NBP1-59476] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

POPDC3 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to POPDC3(popeye domain containing 3) The peptide sequence was selected from the C terminal of POPDC3. Peptide sequence YLLFAQHRYISRLFSVLIGSDIADKLYALNDRVYIGKRYHYDIRLPNFYQ. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: POPDC3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 34 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for POPDC3 Antibody - BSA Free

• bA355M14.1
• MGC22671
• POP3RP11-99L11.2
• popeye domain containing 3
• popeye domain-containing protein 3
• Popeye protein 3

Background

POPDC3 is a member of the POP family of proteins containing three putative transmembrane domains. The protein is expressed in cardiac and skeletal muscle and may play an important role in these tissues during development.This gene encodes a member of the POP family of proteins containing three putative transmembrane domains. This gene is expressed in cardiac and skeletal muscle and may play an important role in these tissues during development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for POPDC3 Antibody (NBP1-59476)(1)

Publication using NBP1-59476

• Bhat KP, Vijay J, Vilas CK, Asundi J et Al. CRISPR activation screens identify the SWI/SNF ATPases as suppressors of ferroptosis Cell Rep 2024-06-13 [PMID: 38870012]

Bioinformatics

• Gene Symbol: POPDC3
• Uniprot:
  • Q9HBV1(Human)