PON2 Antibody - BSA Free

Immunohistochemistry-Paraffin: PON2 Antibody [NBP1-86365] - Staining in human cerebral cortex and pancreas tissues using anti-PON2 antibody. Corresponding PON2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: PON2 Antibody [NBP1-86365] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: PON2 Antibody [NBP1-86365] - Staining of human pancreas shows low expression as expected.

Analysis in control (vector only transfected HEK293T lysate) and PON2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PON2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PON2 Antibody - BSA Free (NBP1-86365) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ENSLLHLKTVKHELLPSVNDITAVGPAHFYATNDHYFSDPFLKYLETYLNLHWANVVYYSPNEVKVVAEGFDSANGINISPDDKYIYVADILAHEIHVLEKHTNMNLTQLKVLE
• Predicted Species: Mouse (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PON2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PON2 Protein (NBP1-86365PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PON2 Antibody - BSA Free

• A-esterase 2
• Aromatic esterase 2
• EC 3.1.1.2
• EC 3.1.1.81
• paraoxonase 2
• paraoxonase nirs
• PON 2
• PON2
• Serum Aryldialkylphosphatase 2
• serum paraoxonase/arylesterase 2

Background

PON2 encodes a member of the paraoxonase gene family, which includes three known members located adjacent to each other on the long arm of chromosome 7. The encoded protein is ubiquitously expressed in human tissues, membrane-bound, and may act as a cellular antioxidant, protecting cells from oxidative stress. Hydrolytic activity against acylhomoserine lactones, important bacterial quorum-sensing mediators, suggests the encoded protein may also play a role in defense responses to pathogenic bacteria. Mutations in this gene may be associated with vascular disease and a number of quantitative phenotypes related to diabetes. Alternatively spliced transcript variants encoding different isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PON2