PON1 Antibody (4X7X2) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PON1 (P27169). TGSEDLEILPNGLAFISSGLKYPGIKSFNPNSPGKILLMDLNEEDPTVLELGITGSKFDVSSFNPHGISTFTDEDNAMYLLVVNHPDAKSTVELFKFQEEE |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
PON1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for PON1 Antibody (4X7X2)
Background
Paraoxonase 1 (PON1) is an arylesterase capable of hydrolyzing a broad spectrum of organophosphate substrates and lactones, and a number of aromatic carboxylic acid esters. PON1 primarily hydrolyzes paroxon, an organophosphorus anticholinesterase compound produced in vivo by oxidation of the insecticide parathion, to produce p-nitrophenol. Polymorphisms in this gene are a risk factor in coronary artery disease.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
Publications for PON1 Antibody (NBP3-16187) (0)
There are no publications for PON1 Antibody (NBP3-16187).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PON1 Antibody (NBP3-16187) (0)
There are no reviews for PON1 Antibody (NBP3-16187).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PON1 Antibody (NBP3-16187) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PON1 Products
Research Areas for PON1 Antibody (NBP3-16187)
Find related products by research area.
|
Blogs on PON1