POLR2D Antibody (1E4-A5)

Images

 
Western Blot: POLR2D Antibody (1E4-A5) [H00005433-M01] - Analysis of POLR2D expression in transfected 293T cell line by POLR2D monoclonal antibody (M01), clone 1E4-A5.Lane 1: POLR2D transfected lysate(16.3 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1E4-A5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

POLR2D Antibody (1E4-A5) Summary

Immunogen
POLR2D (AAH17205, 1 a.a. - 142 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAGGSDPRAGDVEEDASQLIFPKGFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY
Specificity
POLR2D - polymerase (RNA) II (DNA directed) polypeptide D
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
POLR2D
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for POLR2D Antibody (1E4-A5)

  • DNA-directed RNA polymerase II 16 kDa polypeptide
  • DNA-directed RNA polymerase II subunit D
  • DNA-directed RNA polymerase II subunit RPB4
  • HSRBP4
  • HSRPB4
  • polymerase (RNA) II (DNA directed) polypeptide D
  • RBP4
  • RNA polymerase II 16 kDa subunit
  • RNA polymerase II subunit B4
  • RNA polymerase II subunit hsRBP4
  • RPB16

Background

This gene encodes the fourth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit is associated with the polymerase under suboptimal growth conditions and may have a stress protective role. A sequence for a ribosomal pseudogene is contained within the 3' untranslated region of the transcript from this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-594
Species: Hu, Mu, Ca
Applications: WB, IHC-P
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-80851
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88000
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1857
Species: Mu
Applications: WB, Simple Western, IP
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
H00005433-M01
Species: Hu
Applications: WB, ELISA

Publications for POLR2D Antibody (H00005433-M01) (0)

There are no publications for POLR2D Antibody (H00005433-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for POLR2D Antibody (H00005433-M01) (0)

There are no reviews for POLR2D Antibody (H00005433-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for POLR2D Antibody (H00005433-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional POLR2D Products

Bioinformatics Tool for POLR2D Antibody (H00005433-M01)

Discover related pathways, diseases and genes to POLR2D Antibody (H00005433-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for POLR2D Antibody (H00005433-M01)

Discover more about diseases related to POLR2D Antibody (H00005433-M01).
 

Pathways for POLR2D Antibody (H00005433-M01)

View related products by pathway.

Research Areas for POLR2D Antibody (H00005433-M01)

Find related products by research area.

Blogs on POLR2D

There are no specific blogs for POLR2D, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our POLR2D Antibody (1E4-A5) and receive a gift card or discount.

Bioinformatics

Gene Symbol POLR2D
Entrez
OMIM
Uniprot