Treacher Collins syndrome protein Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Treacher Collins syndrome protein Antibody [NBP1-86908] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center.
Immunohistochemistry-Paraffin: Treacher Collins syndrome protein Antibody [NBP1-86908] - Staining of human rectum shows moderate nucleolar and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Treacher Collins syndrome protein Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KSLGNILQAKPTSSPAKGPPQKAGPVAVQVKAEKPMDNSESSEESSDSADSEEAPAAMTAAQAKPALKIPQTKACPKKTNTTAS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TCOF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Treacher Collins syndrome protein Protein (NBP1-86908PEP)
Publications
Read Publication using NBP1-86908.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25064736)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Treacher Collins syndrome protein Antibody

  • MFD1
  • nucleolar trafficking phosphoprotein
  • TCS1
  • Treacher Collins syndrome protein
  • Treacher Collins-Franceschetti syndrome 1
  • treacle protein
  • treacle

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP1-82545
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-45883
Species: Hu, Mu, Rt
Applications: WB, IHC, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-82655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
H00000900-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-86908
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Treacher Collins syndrome protein Antibody (NBP1-86908)(1)

Reviews for Treacher Collins syndrome protein Antibody (NBP1-86908) (0)

There are no reviews for Treacher Collins syndrome protein Antibody (NBP1-86908). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Treacher Collins syndrome protein Antibody (NBP1-86908) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Treacher Collins syndrome protein Products

Bioinformatics Tool for Treacher Collins syndrome protein Antibody (NBP1-86908)

Discover related pathways, diseases and genes to Treacher Collins syndrome protein Antibody (NBP1-86908). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Treacher Collins syndrome protein Antibody (NBP1-86908)

Discover more about diseases related to Treacher Collins syndrome protein Antibody (NBP1-86908).
 

Pathways for Treacher Collins syndrome protein Antibody (NBP1-86908)

View related products by pathway.

PTMs for Treacher Collins syndrome protein Antibody (NBP1-86908)

Learn more about PTMs related to Treacher Collins syndrome protein Antibody (NBP1-86908).
 

Research Areas for Treacher Collins syndrome protein Antibody (NBP1-86908)

Find related products by research area.

Blogs on Treacher Collins syndrome protein

There are no specific blogs for Treacher Collins syndrome protein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Treacher Collins syndrome protein Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TCOF1