Treacher Collins syndrome protein Antibody

Western Blot: Treacher Collins syndrome protein Antibody [NBP1-86908] - Analysis in human cell line CACO-2.

Immunocytochemistry/Immunofluorescence: Treacher Collins syndrome protein Antibody [NBP1-86908] - Staining of human cell line U-2 OS shows localization to nucleoli fibrillar center. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Treacher Collins syndrome protein Antibody [NBP1-86908] - Staining of human testis shows weak to moderate nuclear and nucleolar positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: Treacher Collins syndrome protein Antibody [NBP1-86908] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: Treacher Collins syndrome protein Antibody [NBP1-86908] - Staining of human liver shows very low positivity in hepatocytes.

Immunohistochemistry-Paraffin: Treacher Collins syndrome protein Antibody [NBP1-86908] - Staining of human rectum shows moderate nuclear and nucleolar positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Treacher Collins syndrome protein Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KSLGNILQAKPTSSPAKGPPQKAGPVAVQVKAEKPMDNSESSEESSDSADSEEAPAAMTAAQAKPALKIPQTKACPKKTNTTAS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TCOF1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Treacher Collins syndrome protein Protein (NBP1-86908PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 25064736)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Treacher Collins syndrome protein Antibody

• MFD1
• nucleolar trafficking phosphoprotein
• TCS1
• Treacher Collins syndrome protein
• Treacher Collins-Franceschetti syndrome 1
• treacle protein
• treacle

Background

This gene encodes a nucleolar protein with a LIS1 homology domain. The protein is involved in ribosomal DNA gene transcription through its interaction with upstream binding factor (UBF). Mutations in this gene have been associated with Treacher Collins syndrome, a disorder which includes abnormal craniofacial development. Multiple transcript variants encoding different isoforms have been found for this gene

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Treacher Collins syndrome protein Antibody (NBP1-86908)(1)

Publication using NBP1-86908

• Larsen DH, Hari F, Clapperton JA et al. The NBS1-Treacle complex controls ribosomal RNA transcription in response to DNA damage. Nat Cell Biol 2014-08-01 [PMID: 25064736]

Bioinformatics

• Gene Symbol: TCOF1