POLDIP1 Antibody - BSA Free

Western Blot: POLDIP1 Antibody [NBP1-80103] - Host: Rabbit. Target: KCTD13. Positive control (+): MCF7 Cell Lysate (N10). Negative control (-): Human Kidney (KI). Antibody concentration: 3ug/ml

Immunohistochemistry-Paraffin: POLDIP1 Antibody [NBP1-80103] - Human Brain Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Neural cells (indicated with arrows) 400X mgnification.

Western Blot: POLDIP1 Antibody [NBP1-80103] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

POLDIP1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the N terminal of human KCTD13. Peptide sequence PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCTD13
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 4-8 ug/ml
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 36 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for POLDIP1 Antibody - BSA Free

• BACURD1
• BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 1
• BTB/POZ domain-containing protein KCTD13
• hBACURD1
• PDIP1FKSG86
• POLDIP1TNFAIP1-like protein
• Polymerase delta-interacting protein 1
• potassium channel tetramerisation domain containing 13

Background

KCTD13 is a gene that codes for a widely expressed protein that functions as a substrate-specific adapter that is involved of the maintenance of the cytoskeleton structure via the regulation of the actin cytoskeleton and cell migrationt that is 329 amino acids long and weighs approximately 36 kDa. Studies are being conducted on diseases and disorders relating to this gene, including microephaly. KCTD13 has also been shown to have interactions with KAT7, LNX1, ZMYND19, ARMC7, and VTA1 in pathways such as the cholera infection, hepatic ABC transporter, PKA signaling, and sweet taste signaling pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCTD13
• Uniprot:
  • NP_849194(Human)