POLD3 Antibody (3E2) - Azide and BSA Free Summary
Immunogen
POLD3 (NP_006582, 357 a.a. ~ 466 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PPLEPVPKTEPEPPSVKSSSGENKRKRKRVLKSKTYLDGEGCIVTEKVYESESCTDSEEELNMKTSSVHRPPAMTVKKEPREERKGPKKGTAALGKANRQVSITGFFQRK
Specificity
POLD3 - polymerase (DNA-directed), delta 3, accessory subunit
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
POLD3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Applications/Dilutions
Dilutions
ELISA 1:100-1:2000 Immunocytochemistry/ Immunofluorescence 1:10-1:2000 Western Blot 1:500
Publications
Read Publications using H00010714-M01 in the following applications:
Packaging, Storage & Formulations
Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for POLD3 Antibody (3E2) - Azide and BSA Free
Background
The DNA polymerase delta complex is involved in DNA replication and repair, and it consists of the proliferating cell nuclear antigen (PCNA; MIM 176740), the multisubunit replication factor C (see MIM 102579), and the 4 subunit polymerase complex: POLD1 (MIM 174761), POLD2 (MIM 600815), POLD3, and POLD4 (MIM 611525) (Liu and Warbrick, 2006 [PubMed 16934752]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Ha, Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Ca, Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB, ELISA, ICC/IF
Publications for POLD3 Antibody (H00010714-M01)(15)
We have publications tested in 1 confirmed species: Human.
We have publications tested in 1 application: WB.
Submit a Publication
Filter By Application
All Applications
Filter By Species
All Species
Showing Publications 1 -
10 of 15.
Show All 15 Publications.
Collapse Publications.
Publications using H00010714-M01
Applications
Species
Lu R, Nelson CB, Rogers S et Al. Distinct modes of telomere synthesis and extension contribute to Alternative Lengthening of Telomeres iScience 2023-12-11 [PMID: 38213617]
Rosso I, Jones-Weinert C, Rossiello F et al. Alternative lengthening of telomeres (ALT) cells viability is dependent on C-rich telomeric RNAs Nature communications 2023-11-04 [PMID: 37925537]
Rose AM, Goncalves T, Cunniffe S et al. Induction of the alternative lengthening of telomeres pathway by trapping of proteins on DNA Nucleic acids research 2023-03-20 [PMID: 36940725] (WB, Human) Details: Dilution used in WB 1:500
WB
Human
Madhura D, Theodore P, Nahed J et al. Error-prone repair of stalled replication forks drives mutagenesis and loss of heterozygosity in haploinsufficient BRCA1 cells. Mol Cell. 2022-09-07 [PMID: 36099913]
Shixin C, John W, Nicole B et al. Cockayne syndrome group B protein uses its DNA translocase activity to promote mitotic DNA synthesis DNA Repair (Amst). 2022-06-17 [PMID: 35738143]
Camelia M, Eleftheria K, Maria F et al. DNA replication is highly resilient and persistent under the challenge of mild replication stress. Cell Rep. 2022-04-19 [PMID: 35443178]
Barroso-GonzAlez J, GarcIa-ExpOsito L, Galaviz P et al. Anti-recombination function of MutS alpha restricts telomere extension by ALT-associated homology-directed repair Cell reports 2021-12-07 [PMID: 34879271]
Silva B, Arora R, Bione S, Azzalin CM. TERRA transcription destabilizes telomere integrity to initiate break-induced replication in human ALT cells Nature Communications 2021-06-18 [PMID: 34145295]
Raghunandan M, Geelen D, Majerova E, Decottignies A NHP2 downregulation counteracts hTR-mediated activation of the DNA damage response at ALT telomeres The EMBO journal 2021-02-17 [PMID: 33595114]
Zhang H, Zhao R, Tones J et al. Nuclear body phase separation drives telomere clustering in ALT cancer cells Mol. Biol. Cell 2020-06-24 [PMID: 32579423]
Feng E, Batenburg N, Walker J et al. CSB cooperates with SMARCAL1 to maintain telomere stability in ALT cells. J Cell Sci. 2020-02-17 [PMID: 31974116]
Silva B, Pentz R, Figueira AM et al. FANCM limits ALT activity by restricting telomeric replication stress induced by deregulated BLM and R-loops Nat Commun 2019-05-30 [PMID: 31138795] (WB, Human)
WB
Human
Gao S, Feng S, Ning S et al. An OB-fold complex controls the repair pathways for DNA double-strand breaks. Nat Commun 2018-09-25 [PMID: 30254264]
Minocherhomji S, Ying S, Bjerregaard VA et al. Replication stress activates DNA repair synthesis in mitosis. Nature 2015-12-02 [PMID: 26633632]
Bursomanno S, Beli P, Khan AM et al. Proteome-wide analysis of SUMO2 targets in response to pathological DNA replication stress in human cells. DNA Repair (Amst). 2014-11-25 [PMID: 25497329]
Show All 15 Publications.
Collapse Publications.
Reviews for POLD3 Antibody (H00010714-M01) (0)
There are no reviews for POLD3 Antibody (H00010714-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for POLD3 Antibody (H00010714-M01) (0)
Secondary Antibodies
Isotype Controls
Additional POLD3 Products
Research Areas for POLD3 Antibody (H00010714-M01)
Find related products by research area.
Blogs on POLD3