Podocin/NPHS2 Antibody (2O10G3)

Western Blot: Podocin/NPHS2 Antibody (2O10G3) [NBP3-16111] - Western blot analysis of extracts of various cell lines, using Podocin/NPHS2 antibody (NBP3-16111) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 180s.

• Reactivity: Hu
• Applications: WB
• Clone: 2O10G3
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Podocin/NPHS2 Antibody (2O10G3) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 284-383 of human Podocin/NPHS2 (Q9NP85). AQRQAKVRMIAAEAEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCLSSPSNRTQGSLPFPSPSKPVEPLNPKKKDSPML
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: NPHS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Podocin/NPHS2 Antibody (2O10G3)

• Nephrosis 2
• nephrosis 2, idiopathic, steroid-resistant (podocin)
• NPHS2
• PDCN
• PDCNSRN1podocin
• Podocin
• SRN1

Background

NPHS2 encodes the glomerular protein podocin which plays a role in the regulation of glomerular permeability, and acts as a linker between the plasma membrane and the cytoskeleton. Defects in this gene are the cause of autosomal recessive steroid-resistant nephrotic syndrome (SRN). SRN is characterized by onset between three months and five years, resistance to steroid therapy and rapid progression to end-stage renal disease. An alternative splice variant has been described but its full length sequence has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NPHS2