PNRC1 Antibody

Images

 
Western Blot: PNRC1 Antibody [NBP1-90837] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: PNRC1 Antibody [NBP1-90837] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PNRC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QLVHGIHLYEQPKINRQKSKYNLPLTKITSAKRNENNFWQDSVSSDRIQKQEKKPFKNTENIKNSHLKKSAFLTEVSQKENYAGAKFSDPPSPSVLPK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PNRC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PNRC1 Protein (NBP1-90837PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PNRC1 Antibody

  • B4-2
  • PNAS-145
  • PROL2
  • proline rich 2 protein
  • proline-rich nuclear receptor coactivator 1
  • proline-rich polypeptide 2
  • proline-rich protein 2
  • protein B4-2
  • PRR2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB25301
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-01198
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP1-76690
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-55986
Species: Hu
Applications: ICC/IF
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-38289
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-46078
Species: Hu
Applications: WB, IHC
NB100-2727
Species: Hu, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-81289
Species: Hu
Applications: IHC, IHC-P
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P

Publications for PNRC1 Antibody (NBP1-90837) (0)

There are no publications for PNRC1 Antibody (NBP1-90837).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PNRC1 Antibody (NBP1-90837) (0)

There are no reviews for PNRC1 Antibody (NBP1-90837). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PNRC1 Antibody (NBP1-90837) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PNRC1 Products

Bioinformatics Tool for PNRC1 Antibody (NBP1-90837)

Discover related pathways, diseases and genes to PNRC1 Antibody (NBP1-90837). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PNRC1 Antibody (NBP1-90837)

Discover more about diseases related to PNRC1 Antibody (NBP1-90837).
 

Pathways for PNRC1 Antibody (NBP1-90837)

View related products by pathway.

Blogs on PNRC1

There are no specific blogs for PNRC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PNRC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PNRC1