PRR4 Antibody - BSA Free

Immunohistochemistry-Paraffin: PRR4 Antibody [NBP1-81289] - Analysis in human salivary gland and colon tissues. Corresponding PRR4 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: PRR4 Antibody [NBP1-81289] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.

Immunohistochemistry-Paraffin: PRR4 Antibody [NBP1-81289] - Staining of human colon shows no cytoplasmic positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: PRR4 Antibody [NBP1-81289] - Staining of human salivary gland shows moderate to strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: PRR4 Antibody [NBP1-81289] - Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PRR4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PRR4 Antibody - BSA Free (NBP1-81289) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QSTDNDVNYEDFTFTIPDVEDSSQRPDQGPQRPPPEGLLPRPPGDSGNQDDGPQQRPP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PRR4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PRR4 Protein (NBP1-81289PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for PRR4 Antibody - BSA Free

• DKFZp779L1763
• Lacrimal proline-rich protein
• LPRPlacrimal proline rich protein
• Nasopharyngeal carcinoma-associated proline-rich protein 4
• PROL4nasopharyngeal carcinoma-associated proline rich 4
• proline rich 4 (lacrimal)
• proline-rich polypeptide 4
• proline-rich protein 4

Background

Lacrimal proline rich protein is a member of the proline-rich protein family which lacks a conserved repetitive domain. It may have a role in protective functions in the eye. Two alternatively spliced transcript variants that encode different proteins have been described for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PRR4