PNPO Antibody - BSA Free

Western Blot: PNPO Antibody [NBP1-87303] - Analysis using Anti-PNPO antibody NBP1-87303 (A) shows similar pattern to independent antibody NBP1-87302 (B).

Immunocytochemistry/Immunofluorescence: PNPO Antibody [NBP1-87303] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: PNPO Antibody [NBP1-87303] - Staining of human colon.

Immunohistochemistry-Paraffin: PNPO Antibody [NBP1-87303] - Immunohistochemical staining of human kidney shows strong positivity in cells in tubules.

Immunohistochemistry-Paraffin: PNPO Antibody [NBP1-87303] - Staining of human colon, kidney, liver and lymph node using Anti-PNPO antibody NBP1-87303 (A) shows similar protein distribution across tissues to independent antibody NBP1-87302 (B).

Immunohistochemistry-Paraffin: PNPO Antibody [NBP1-87303] - Staining of human kidney.

Immunohistochemistry-Paraffin: PNPO Antibody [NBP1-87303] - Staining of human liver.

Immunohistochemistry-Paraffin: PNPO Antibody [NBP1-87303] - Staining of human lymph node.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PNPO Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PNPO Antibody - BSA Free (NBP1-87303) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SSVIPDREYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPTGDSPLGPMTHRGEEDWLYERLAP
• Predicted Species: Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PNPO
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization, Use PFA/Triton X-100. Western Blot verified by a customer review.
• Control Peptide:

  PNPO Protein (NBP1-87303PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PNPO Antibody - BSA Free

• EC 1.4.3.5
• FLJ10535
• PDXPO
• pyridoxal 5'-phosphate synthase
• pyridoxamine 5'-phosphate oxidase
• Pyridoxamine-phosphate oxidase
• pyridoxine 5'-phosphate oxidase
• pyridoxine-5'-phosphate oxidase

Background

Vitamin B6, or pyridoxal 5-prime-phosphate (PLP), is critical for normal cellular function, and some cancer cells have notable differences in vitamin B6 metabolism compared to their normal counterparts. The rate-limiting enzyme in vitamin B6 synthesis is pyridoxine-5-prime-phosphate (PNP) oxidase (PNPO; EC 1.4.3.5).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PNPO