PNPLA4 Antibody

Images

 
Western Blot: PNPLA4 Antibody [NBP1-84958] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: ...read more
Immunohistochemistry-Paraffin: PNPLA4 Antibody [NBP1-84958] - Staining of human small intestine shows moderate cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PNPLA4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QFTYKFAEEIRRQSFGAVTPGYDFMARLRSGMESILPPSAHELAQNRLHVSITNAKTRENHLVSTFSSREDLIKVLLASSFVPIYAGLKLVEYKGQKWVDGGLTNALPILPVGRTVTISPFSGRLDISPQDKGQLD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PNPLA4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PNPLA4 Protein (NBP1-84958PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PNPLA4 Antibody

  • calcium independent phospholipases A2 eta
  • DXS1283Epatatin-like phospholipase domain-containing protein 4
  • GS2EC 3.1.1.3
  • IPLA2 eta
  • patatin-like phospholipase domain containing 4
  • Protein GS2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-92156
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-00487
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-41536
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-00227
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-81586
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB300-943
Species: Mu
Applications: WB, ICC/IF, IHC-P, PEP-ELISA
NBP2-16679
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00005873-M02
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-37253
Species: Hu, Mu, Rt
Applications: WB
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NB110-41487
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, ICC/IF
H00285848-B01P
Species: Hu
Applications: WB, ELISA
NB110-40764
Species: Hu, Mu, Po, Pm
Applications: WB, ICC/IF
NBP1-90095
Species: Hu
Applications: IHC, IHC-P

Publications for PNPLA4 Antibody (NBP1-84958) (0)

There are no publications for PNPLA4 Antibody (NBP1-84958).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PNPLA4 Antibody (NBP1-84958) (0)

There are no reviews for PNPLA4 Antibody (NBP1-84958). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PNPLA4 Antibody (NBP1-84958) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PNPLA4 Products

Bioinformatics Tool for PNPLA4 Antibody (NBP1-84958)

Discover related pathways, diseases and genes to PNPLA4 Antibody (NBP1-84958). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PNPLA4 Antibody (NBP1-84958)

Discover more about diseases related to PNPLA4 Antibody (NBP1-84958).
 

Pathways for PNPLA4 Antibody (NBP1-84958)

View related products by pathway.

Blogs on PNPLA4

There are no specific blogs for PNPLA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PNPLA4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PNPLA4