Myosin 5a Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Myosin 5a Antibody [NBP1-92156] - Analysis in human cerebral cortex and liver tissues. Corresponding Myosin 5a RNA-seq data are presented for the same tissues.
Immunocytochemistry/ Immunofluorescence: Myosin 5a Antibody [NBP1-92156] - Staining of human cell line A-431 shows localization to microtubule organizing center & focal adhesion sites. Antibody staining shown in green.
Immunohistochemistry-Paraffin: Myosin 5a Antibody [NBP1-92156] - Staining of human kIdney shows moderate memberanous positivity in cells in tubules.
Immunohistochemistry-Paraffin: Myosin 5a Antibody [NBP1-92156] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: Myosin 5a Antibody [NBP1-92156] - Staining of human cerebral cortex shows strong membranous positivity in neuropil.
Immunohistochemistry-Paraffin: Myosin 5a Antibody [NBP1-92156] - Staining of human hippocampus shows strong cytoplasmic positivity in pyramidal cells.
Immunohistochemistry-Paraffin: Myosin 5a Antibody [NBP1-92156] - Staining of human kidney shows moderate membranous positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Myosin 5a Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QNLQLPPEARIEASLQHEITRLTNENLDLMEQLEKQDKTVRKLKKQLKVFAKKIGELEVGQMENISPGQIIDEPIRPVNIPRKEKDFQGMLEYKKEDEQKLVKNLILELKPRGVAVNLIPG
Predicted Species
Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MYO5A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Knockdown Validated
Application Notes
IHC-P Retrieval method: HIER pH6, ICC/IF Fixation/Permeabilization: PFA/Triton X-100. Knockdown validation (Barthelemy-Requin et al).
Control Peptide
Myosin 5a Protein (NBP1-92156PEP)
Publications
Read Publications using
NBP1-92156 in the following applications:

  • 2 publications
  • IHC
    1 publication
  • KD
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID:32815283)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Myosin 5a Antibody

  • Dilute myosin heavy chain, non-muscle
  • GS1myosin, heavy polypeptide kinase
  • MYH12myosin-12
  • MYO5
  • Myosin heavy chain 12
  • myosin V
  • myosin VA (heavy chain 12, myoxin)
  • myosin VA (heavy polypeptide 12, myoxin)
  • Myosin-12
  • myosin-Va
  • Myoxin
  • MYR12

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
H00005873-M02
Species: Hu, Mu, Rb
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, S-ELISA, WB
NBP2-45883
Species: Hu
Applications: IHC, WB
NBP2-19878
Species: Hu
Applications: IHC, IHC-P, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC, WB
MAB4470
Species: All-Multi
Applications: ICC, IHC, WB
H00004646-M02
Species: Hu, Mu
Applications: ELISA, IHC, S-ELISA, WB
NB100-1278
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-67796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00010097-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NB300-996
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-93677
Species: Hu, Mu, Rt
Applications: WB
NBP1-87746
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, Simple Western, WB
AF1444
Species: Mu
Applications: IHC, WB
NBP1-30955
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for Myosin 5a Antibody (NBP1-92156)(7)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 3 applications: ICC/IF, IHC, KD.


Filter By Application
ICC/IF
(2)
IHC
(1)
KD
(1)
All Applications
Filter By Species
Human
(4)
Mouse
(1)
All Species

Reviews for Myosin 5a Antibody (NBP1-92156) (0)

There are no reviews for Myosin 5a Antibody (NBP1-92156). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Myosin 5a Antibody (NBP1-92156) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Myosin 5a Products

Bioinformatics Tool for Myosin 5a Antibody (NBP1-92156)

Discover related pathways, diseases and genes to Myosin 5a Antibody (NBP1-92156). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Myosin 5a Antibody (NBP1-92156)

Discover more about diseases related to Myosin 5a Antibody (NBP1-92156).
 

Pathways for Myosin 5a Antibody (NBP1-92156)

View related products by pathway.

PTMs for Myosin 5a Antibody (NBP1-92156)

Learn more about PTMs related to Myosin 5a Antibody (NBP1-92156).
 

Research Areas for Myosin 5a Antibody (NBP1-92156)

Find related products by research area.

Blogs on Myosin 5a

There are no specific blogs for Myosin 5a, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Myosin 5a Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MYO5A