PNMA2 Antibody

Images

 
Western Blot: PNMA2 Antibody [NBP1-82806] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: PNMA2 Antibody [NBP1-82806] - Staining of human cerebral cortex shows moderate cytoplasmic and nucleolar positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PNMA2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KQENANAVLLELLEDTDVSAIPSEVQGKGGVWKVIFKTPNQDTEFLERLNLFLEKEGQTVSGMFRALGQEGVSPATVPCISPELLAHLLGQAMAHAPQPLLPMRYRKLRVFSGSAVPAPEEESFEVWLEQATEIVKEWPVTEAEKKRWL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PNMA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PNMA2 Protein (NBP1-82806PEP)
Publications
Read Publications using NBP1-82806.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (82%). Reactivity reported in scientific literature (PMID: 22173169)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PNMA2 Antibody

  • MA2KIAA0883
  • MM2
  • Onconeuronal antigen Ma2
  • paraneoplastic antigen MA2,40 kDa neuronal protein
  • Paraneoplastic neuronal antigen MM2
  • retrotransposon gag domain containing 2
  • RGAG2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56605
Species: Av, Bv, Sh
Applications: WB
AF5329
Species: Hu
Applications: WB, IHC
NBP1-82639
Species: Hu
Applications: WB, IHC, IHC-P
H00009240-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00007001-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-88263
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00079092-T01
Species: Hu
NBP1-80918
Species: Hu
Applications: IHC, IHC-P
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NB100-93470
Species: Hu
Applications: WB, PEP-ELISA
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22187
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, IF
MAB2327
Species: Hu
Applications: WB, IP
NBP1-82806
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PNMA2 Antibody (NBP1-82806)(3)

Reviews for PNMA2 Antibody (NBP1-82806) (0)

There are no reviews for PNMA2 Antibody (NBP1-82806). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PNMA2 Antibody (NBP1-82806) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PNMA2 Products

Bioinformatics Tool for PNMA2 Antibody (NBP1-82806)

Discover related pathways, diseases and genes to PNMA2 Antibody (NBP1-82806). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PNMA2 Antibody (NBP1-82806)

Discover more about diseases related to PNMA2 Antibody (NBP1-82806).
 

Pathways for PNMA2 Antibody (NBP1-82806)

View related products by pathway.

Research Areas for PNMA2 Antibody (NBP1-82806)

Find related products by research area.

Blogs on PNMA2

There are no specific blogs for PNMA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PNMA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PNMA2