PNMA1 Antibody - BSA Free

Western Blot: PNMA1 Antibody [NBP1-82808] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: PNMA1 Antibody [NBP1-82808] - Staining of human colon.

Immunohistochemistry-Paraffin: PNMA1 Antibody [NBP1-82808] - Staining of human cerebral cortex shows high expression.

Immunohistochemistry-Paraffin: PNMA1 Antibody [NBP1-82808] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: PNMA1 Antibody [NBP1-82808] - Staining in human cerebral cortex and pancreas tissues using anti-PNMA1 antibody. Corresponding PNMA1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: PNMA1 Antibody [NBP1-82808] - Staining of human cerebral cortex, colon, hippocampus and testis using Anti-PNMA1 antibody NBP1-82808 (A) shows similar protein distribution across tissues to independent antibody NBP1-82807 (B).

Immunohistochemistry-Paraffin: PNMA1 Antibody [NBP1-82808] - Staining of human hippocampus.

Immunohistochemistry-Paraffin: PNMA1 Antibody [NBP1-82808] - Staining of human testis.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PNMA1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PNMA1 Antibody - BSA Free (NBP1-82808) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RLMESLRGPAADVIRILKSNNPAITTAECLKALEQVFGSVESSRDAQIKFLNTYQNPGEKLSAYVIRLEPLLQKVVEKGAIDKDNVNQARLEQVIAGANHSGAIRRQLWLTGAGEGPAPNLFQLLVQIREEEAKEEEEEAEATLLQLGL
• Predicted Species: Mouse (92%), Rat (95%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PNMA1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PNMA1 Protein (NBP1-82808PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PNMA1 Antibody - BSA Free

• MA1Neuron- and testis-specific protein 1,37 kDa neuronal protein
• paraneoplastic antigen MA1
• paraneoplastic neuronal antigen MA1

Background

PNMA1 (Paraneoplastic antigen MA1) is a protein that is highly restricted to the brain and testis. A paraneoplastic phenomenon is a disease or symptom that is the consequence of the presence of cancer in the body, but is not due to the local presence of cancer cells. These phenomena are mediated by humoral factors (by hormones or cytokines) excreted by tumor cells or by an immune response against the tumor. Sometimes the symptoms of paraneoplastic syndromes show even before the diagnosis of a malignancy. Paraneoplastic syndromes can be divided into 4 main categories: mucocutane paraneoplastic syndromes, neurological paraneoplastic syndromes, haematological paraneoplastic syndromes and endocrine metabolic syndromes. Antibodies against PNMA1 are present in sera from patients suffering from paraneoplastic neurological disorders.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PNMA1