PNMA1 Antibody

Images

 
Western Blot: PNMA1 Antibody [NBP1-52936] - Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PNMA1 Antibody Summary

Immunogen
Synthetic peptides corresponding to PNMA1(paraneoplastic antigen MA1) The peptide sequence was selected from the middle region of PNMA1. Peptide sequence LNTYQNPGEKLSAYVIRLEPLLQKVVEKGAIDKDNVNQARLEQVIAGANH.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PNMA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PNMA1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PNMA1 Antibody

  • MA1Neuron- and testis-specific protein 1,37 kDa neuronal protein
  • paraneoplastic antigen MA1
  • paraneoplastic neuronal antigen MA1

Background

PNMA1 encodes a protein that is highly restricted to the brain and testis. Anti-PNMA1 reacts mainly with subnuclear elements (including the nucleoli) and to a lesser degree the cytoplasm.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03547
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP1-82806
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89575
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB100-793
Species: Hu
Applications: WB, PEP-ELISA
NBP2-13820
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NB100-64347
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Eq, Ft, Gt, GP, Mk, Rb
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NB110-38889
Species: Hu
Applications: WB, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF154
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready, KO
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-52936
Species: Hu
Applications: WB

Publications for PNMA1 Antibody (NBP1-52936) (0)

There are no publications for PNMA1 Antibody (NBP1-52936).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PNMA1 Antibody (NBP1-52936) (0)

There are no reviews for PNMA1 Antibody (NBP1-52936). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PNMA1 Antibody (NBP1-52936) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PNMA1 Products

Bioinformatics Tool for PNMA1 Antibody (NBP1-52936)

Discover related pathways, diseases and genes to PNMA1 Antibody (NBP1-52936). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PNMA1 Antibody (NBP1-52936)

Discover more about diseases related to PNMA1 Antibody (NBP1-52936).
 

Pathways for PNMA1 Antibody (NBP1-52936)

View related products by pathway.

Blogs on PNMA1

There are no specific blogs for PNMA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PNMA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PNMA1
Uniprot