PMVK/phosphomevalonate kinase Antibody - BSA Free

Western Blot: PMVK/phosphomevalonate kinase Antibody [NBP1-83142] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunohistochemistry-Paraffin: PMVK/phosphomevalonate kinase Antibody [NBP1-83142] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry: PMVK/phosphomevalonate kinase Antibody [NBP1-83142] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: PMVK/phosphomevalonate kinase Antibody [NBP1-83142] - Staining of human gastrointestinal shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: PMVK/phosphomevalonate kinase Antibody [NBP1-83142] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PMVK/phosphomevalonate kinase Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit PMVK/phosphomevalonate kinase Antibody - BSA Free (NBP1-83142) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PMVK
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  PMVK/phosphomevalonate kinase Protein (NBP1-83142PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PMVK/phosphomevalonate kinase Antibody - BSA Free

• hPMK
• HUMPMKI
• phosphomevalonate kinase
• PMKA
• PMKASE
• PMKEC 2.7.4.2
• PMKI

Background

PMVK (EC 2.7.4.2) is a peroxisomal enzyme that catalyzes the conversion of mevalonate 5-phosphate into mevalonate 5-diphosphate as the fifth reaction of the cholesterol biosynthetic pathway.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PMVK