MAN2C1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MAN2C1 Antibody [NBP1-87729] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: MAN2C1 Antibody [NBP1-87729] - Staining of human fallopian tube shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAN2C1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VLSSFLTPERLPYQEAVQRDFRPAQVGDSFGPTWWTCWFRVELTIPEAWVGQEVHLCWESDGEGLVWRDGEPVQGLTKEGEKTSYVLTDRLGERDPRSLTLYVEVA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAN2C1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MAN2C1 Protein (NBP1-87729PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAN2C1 Antibody

  • Alpha mannosidase 6A8B
  • Alpha-D-mannoside mannohydrolase
  • alpha-mannosidase 2C1
  • DKFZp686E23167
  • EC 3.2.1.24
  • MAN6A8
  • MANA1
  • MANAMGC87979
  • Mannosidase alpha class 2C member 1
  • mannosidase, alpha 6A8
  • mannosidase, alpha A, cytoplasmic
  • mannosidase, alpha, class 2C, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02043
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-47384
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13443
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57753
Species: Hu
Applications: WB, ICC/IF
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81326
Species: Hu
Applications: IHC, IHC-P
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83357
Species: Hu
Applications: WB, IHC, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-47914
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP1-54851
Species: Hu
Applications: WB
NBP1-87729
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MAN2C1 Antibody (NBP1-87729) (0)

There are no publications for MAN2C1 Antibody (NBP1-87729).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAN2C1 Antibody (NBP1-87729) (0)

There are no reviews for MAN2C1 Antibody (NBP1-87729). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MAN2C1 Antibody (NBP1-87729) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAN2C1 Products

Bioinformatics Tool for MAN2C1 Antibody (NBP1-87729)

Discover related pathways, diseases and genes to MAN2C1 Antibody (NBP1-87729). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAN2C1 Antibody (NBP1-87729)

Discover more about diseases related to MAN2C1 Antibody (NBP1-87729).
 

Pathways for MAN2C1 Antibody (NBP1-87729)

View related products by pathway.

PTMs for MAN2C1 Antibody (NBP1-87729)

Learn more about PTMs related to MAN2C1 Antibody (NBP1-87729).

Blogs on MAN2C1

There are no specific blogs for MAN2C1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAN2C1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAN2C1
Entrez
Uniprot