PMM2/Phosphomannomutase 2 Antibody

Images

 
Western Blot: PMM2/Phosphomannomutase 2 Antibody [NBP1-85716] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Independent Antibodies: PMM2/Phosphomannomutase 2 Antibody [NBP1-85716] - Analysis using Anti-PMM2 antibody NBP1-85716 (A) shows similar pattern to independent antibody NBP2-57753 (B).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

PMM2/Phosphomannomutase 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: WDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PMM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PMM2/Phosphomannomutase 2 Antibody

  • CDG1
  • CDG1a
  • CDGS
  • EC 5.4.2.8
  • phosphomannomutase 2
  • PMM 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02043
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87729
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87055
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-64959
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze, Dr(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP, KD, KO
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00005555-P01
Species: Hu
NBP2-66861
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF6387
Species: Hu
Applications: WB
NBP1-91150
Species: Hu
Applications: IHC, IHC-P

Publications for PMM2/Phosphomannomutase 2 Antibody (NBP1-85716) (0)

There are no publications for PMM2/Phosphomannomutase 2 Antibody (NBP1-85716).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PMM2/Phosphomannomutase 2 Antibody (NBP1-85716) (0)

There are no reviews for PMM2/Phosphomannomutase 2 Antibody (NBP1-85716). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PMM2/Phosphomannomutase 2 Antibody (NBP1-85716) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional PMM2/Phosphomannomutase 2 Products

Bioinformatics Tool for PMM2/Phosphomannomutase 2 Antibody (NBP1-85716)

Discover related pathways, diseases and genes to PMM2/Phosphomannomutase 2 Antibody (NBP1-85716). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PMM2/Phosphomannomutase 2 Antibody (NBP1-85716)

Discover more about diseases related to PMM2/Phosphomannomutase 2 Antibody (NBP1-85716).
 

Pathways for PMM2/Phosphomannomutase 2 Antibody (NBP1-85716)

View related products by pathway.

PTMs for PMM2/Phosphomannomutase 2 Antibody (NBP1-85716)

Learn more about PTMs related to PMM2/Phosphomannomutase 2 Antibody (NBP1-85716).
 

Research Areas for PMM2/Phosphomannomutase 2 Antibody (NBP1-85716)

Find related products by research area.

Blogs on PMM2/Phosphomannomutase 2

There are no specific blogs for PMM2/Phosphomannomutase 2, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PMM2/Phosphomannomutase 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PMM2
COVID-19 update