PLP2 Antibody


Western Blot: PLP2 Antibody [NBP1-62539] - HepG2 cell lysate, concentration 1.25ug/ml.

Product Details

Reactivity Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, ShSpecies Glossary
Applications WB

Order Details

PLP2 Antibody Summary

Synthetic peptides corresponding to PLP2(proteolipid protein 2 (colonic epithelium-enriched)) The peptide sequence was selected from the middle region of PLP2. Peptide sequence LVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against PLP2 and was validated on Western blot.
Theoretical MW
17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for PLP2 Antibody

  • A4 differentiation-dependent protein
  • A4A4LSB
  • A4-LSB
  • Differentiation-dependent protein A4
  • Intestinal membrane A4 protein
  • MGC126187
  • proteolipid protein 2 (colonic epithelium-enriched)
  • proteolipid protein 2


PLP2 may play a role in cell differentiation in the intestinal epithelium.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ChIP, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Ye, Ze
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu
Applications: WB, Flow, IHC
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IF
Species: Hu, Mu, Rt, Mk
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, In vitro, CyTOF-ready
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF

Publications for PLP2 Antibody (NBP1-62539) (0)

There are no publications for PLP2 Antibody (NBP1-62539).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLP2 Antibody (NBP1-62539) (0)

There are no reviews for PLP2 Antibody (NBP1-62539). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLP2 Antibody (NBP1-62539) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional PLP2 Products

Bioinformatics Tool for PLP2 Antibody (NBP1-62539)

Discover related pathways, diseases and genes to PLP2 Antibody (NBP1-62539). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLP2 Antibody (NBP1-62539)

Discover more about diseases related to PLP2 Antibody (NBP1-62539).

Pathways for PLP2 Antibody (NBP1-62539)

View related products by pathway.

PTMs for PLP2 Antibody (NBP1-62539)

Learn more about PTMs related to PLP2 Antibody (NBP1-62539).

Blogs on PLP2

There are no specific blogs for PLP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PLP2 Antibody and receive a gift card or discount.


Gene Symbol PLP2