PLOD1 Antibody

Images

 
Western Blot: PLOD1 Antibody [NBP2-31885] - Analysis in human cell line U-251 MG.
Immunohistochemistry-Paraffin: PLOD1 Antibody [NBP2-31885] - Staining of human placenta shows cytoplasmic positivity in decidual cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLOD1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YISNIYLIKGSALRGELQSSDLFHHSKLDPDMAFCANIRQQDVFMFLTNRHTLGHLLSLDSYRTTHLHNDLWEVFSN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLOD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PLOD1 Protein (NBP2-31885PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLOD1 Antibody

  • 2-oxoglutarate 5-dioxygenase 1
  • EC 1.14.11.4
  • Ehlers-Danlos syndrome type VI)
  • FLJ42041
  • LH1
  • LLH
  • lysine hydroxylase
  • Lysyl hydroxylase 1
  • PLODLH
  • procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase (lysine hydroxylase
  • procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase 1
  • procollagen-lysine
  • procollagen-lysine, 2-oxoglutarate 5-dioxygenase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-22444
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IF
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-45825
Species: Hu
Applications: WB, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
MAB4169
Species: Hu
Applications: WB, IHC
H00093659-T01
Species: Hu
NBP2-31885
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PLOD1 Antibody (NBP2-31885) (0)

There are no publications for PLOD1 Antibody (NBP2-31885).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLOD1 Antibody (NBP2-31885) (0)

There are no reviews for PLOD1 Antibody (NBP2-31885). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLOD1 Antibody (NBP2-31885) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLOD1 Products

Bioinformatics Tool for PLOD1 Antibody (NBP2-31885)

Discover related pathways, diseases and genes to PLOD1 Antibody (NBP2-31885). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PLOD1 Antibody (NBP2-31885)

Discover more about diseases related to PLOD1 Antibody (NBP2-31885).
 

Pathways for PLOD1 Antibody (NBP2-31885)

View related products by pathway.

PTMs for PLOD1 Antibody (NBP2-31885)

Learn more about PTMs related to PLOD1 Antibody (NBP2-31885).

Blogs on PLOD1

There are no specific blogs for PLOD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLOD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLOD1
Uniprot