PLBD2 Antibody

Images

 
Western Blot: PLBD2 Antibody [NBP1-90681] - Analysis in human cell line A-549.
Immunohistochemistry-Paraffin: PLBD2 Antibody [NBP1-90681] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PLBD2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GDWFSYDGSPRAQIFRRNQSLVQDMDSMVRLMRYNDFLHDPLSLCKACNPQPNGENAISARSDLNPANGSYPFQALRQRSHGGIDVKVTSMSLARILSLLAASGPTWDQVPPFQWSTS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PLBD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PLBD2 Recombinant Protein Antigen (NBP1-90681PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PLBD2 Antibody

  • LAMA-like protein 2,76 kDa protein
  • lamina ancestor homolog 2
  • mannose-6-phosphate protein associated protein p76
  • P76
  • phospholipase B domain containing 2
  • phospholipase B domain-containing protein 2
  • phospholipase B-like 2 32 kDa form
  • phospholipase B-like 2 45 kDa form
  • PLB homolog 2
  • putative phospholipase B-like 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
AF3926
Species: Hu, Mu, Rt
Applications: WB
H00010963-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF2485
Species: Hu
Applications: WB, IHC, IP
NBP1-80905
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02148
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP1-23000
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NB200-191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-83254
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NB100-1834
Species: Hu
Applications: WB, ICC/IF, Flow-IC
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00009527-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82785
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-14335
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90681
Species: Hu
Applications: WB, IHC, IHC-P

Publications for PLBD2 Antibody (NBP1-90681) (0)

There are no publications for PLBD2 Antibody (NBP1-90681).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLBD2 Antibody (NBP1-90681) (0)

There are no reviews for PLBD2 Antibody (NBP1-90681). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PLBD2 Antibody (NBP1-90681) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PLBD2 Products

Bioinformatics Tool for PLBD2 Antibody (NBP1-90681)

Discover related pathways, diseases and genes to PLBD2 Antibody (NBP1-90681). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on PLBD2

There are no specific blogs for PLBD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PLBD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PLBD2