Use1/UBE2Z Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: RSELLGTDSAEPEMDVRKRTGVAGSQPVSEKQSAAELDLVLQRHQNLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKTESERLEQHTQKSVNW |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
USE1 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200-1:500
- Western Blot 1:100-1:500
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Use1/UBE2Z Antibody
Background
SNARE that may be involved in targeting and fusion of Golgi-derived retrograde transport vesicles with the ER
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: Flow, ICC/IF, PA, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Publications for Use1/UBE2Z Antibody (NBP1-82785) (0)
There are no publications for Use1/UBE2Z Antibody (NBP1-82785).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Use1/UBE2Z Antibody (NBP1-82785) (0)
There are no reviews for Use1/UBE2Z Antibody (NBP1-82785).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Use1/UBE2Z Antibody (NBP1-82785) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Use1/UBE2Z Products
Bioinformatics Tool for Use1/UBE2Z Antibody (NBP1-82785)
Discover related pathways, diseases and genes to Use1/UBE2Z Antibody (NBP1-82785). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Use1/UBE2Z Antibody (NBP1-82785)
Discover more about diseases related to Use1/UBE2Z Antibody (NBP1-82785).
| | Pathways for Use1/UBE2Z Antibody (NBP1-82785)
View related products by pathway.
|
PTMs for Use1/UBE2Z Antibody (NBP1-82785)
Learn more about PTMs related to Use1/UBE2Z Antibody (NBP1-82785).
| | Research Areas for Use1/UBE2Z Antibody (NBP1-82785)
Find related products by research area.
|
Blogs on Use1/UBE2Z