![Immunohistochemistry-Paraffin: Plasmolipin Antibody [NBP2-13777] - Staining in human cerebral cortex and lymph node tissues using anti-PLLP antibody. Corresponding PLLP RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Plasmolipin-Antibody-Immunohistochemistry-Paraffin-NBP2-13777-img0005.jpg "Immunohistochemistry-Paraffin: Plasmolipin Antibody [NBP2-13777] - Staining in human cerebral cortex and lymph node tissues using anti-PLLP antibody. Corresponding PLLP RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit Plasmolipin Antibody - BSA Free (NBP2-13777) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MAEFPSKVSTRTSSPAQGAEASVSALRPDLGFVRS |
| Predicted Species | Mouse (94%), Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PLLP |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Western_Blot_5819.jpg)
![Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Immunocytochemistry__Immunofluorescence_19720.jpg)
![Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Immunocytochemistry__Immunofluorescence_19954.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Plasmolipin Antibody (NBP2-13777)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PLLP |
![Immunohistochemistry-Paraffin: Plasmolipin Antibody [NBP2-13777] - Staining of human lymph node shows low expression as expected.](http://images.novusbio.com/fullsize/Plasmolipin-Antibody-Immunohistochemistry-Paraffin-NBP2-13777-img0004.jpg "Immunohistochemistry-Paraffin: Plasmolipin Antibody [NBP2-13777] - Staining of human lymph node shows low expression as expected.")
![Immunohistochemistry-Paraffin: Plasmolipin Antibody [NBP2-13777] - Staining of human cerebral cortex shows high expression.](http://images.novusbio.com/fullsize/Plasmolipin-Antibody-Immunohistochemistry-Paraffin-NBP2-13777-img0003.jpg "Immunohistochemistry-Paraffin: Plasmolipin Antibody [NBP2-13777] - Staining of human cerebral cortex shows high expression.")
![Immunohistochemistry PTHLH/PTHrP Antibody (677939) [Unconjugated]](https://images.novusbio.com/images2/PTHLH_MAB6734_Immunohistochemistry_10816.jpg)
![Neutralization CX3CL1/Fractalkine Antibody [Unconjugated]](https://images.novusbio.com/images2/CX3CL1_AF365_Block_Neutralize_8860.jpg)
![Western Blot CX3CL1/Fractalkine Antibody [Unconjugated]](https://images.novusbio.com/images/af365_human-cx3cl1-fractalkine-affinity-purified-polyclonal-ab-8120255552865.jpg)
![N/A CCL22/MDC [HRP]](https://images.novusbio.com/images2/CCL22_DMD00_ELISA_142.jpg)
![N/A CCL22/MDC [HRP]](https://images.novusbio.com/images2/DATA_CCL22_DMD00_ELISA_762.jpg)
![N/A CCL17/TARC [HRP]](https://images.novusbio.com/images2/DATA_CCL17_MCC170_ELISA_950.jpg)
![N/A CCL17/TARC [HRP]](https://images.novusbio.com/images2/CCL17_MCC170_ELISA_247.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")