Plasmolipin Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: MAEFPSKVSTRTSSPAQGAEASVSALRPDLGFVRS |
| Predicted Species |
Mouse (94%), Rat (91%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PLLP |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Plasmolipin Antibody - BSA Free
Background
Appears to be involved in myelination. Could also participate in ion transport events as addition of plasmolipin to lipid bilayers induces the formation of ion channels, which are voltage-dependent and K(+)-selective
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RIA, RI, WB
Species: Bv(-), Hu, Mu(-), Pm, Rt(-)
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Rt
Applications: BA
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: Neut, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: Flow, In vitro
Species: Hu, Mu, Rt
Applications: IHC
Publications for Plasmolipin Antibody (NBP2-13777) (0)
There are no publications for Plasmolipin Antibody (NBP2-13777).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Plasmolipin Antibody (NBP2-13777) (0)
There are no reviews for Plasmolipin Antibody (NBP2-13777).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Plasmolipin Antibody (NBP2-13777) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Plasmolipin Products
Research Areas for Plasmolipin Antibody (NBP2-13777)
Find related products by research area.
|
Blogs on Plasmolipin