Plasma Kallikrein/KLKB1 Antibody

Images

 
Western Blot: Plasma Kallikrein 1B Antibody [NBP1-74210] - Titration: 1.0 ug/ml Positive Control: Rat Brain.

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Plasma Kallikrein/KLKB1 Antibody Summary

Immunogen
Synthetic peptides corresponding to the C terminal of Klkb1. Immunizing peptide sequence GPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQSSK.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLKB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Klkb1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Plasma Kallikrein/KLKB1 Antibody

  • EC 3.4.21
  • EC 3.4.21.34
  • Fletcher factor
  • kallikrein B, plasma (Fletcher factor) 1
  • kininogenin
  • KLK3plasma kallikrein
  • KLKB1
  • plasma kallikrein heavy chain
  • plasma kallikrein light chain
  • Plasma Kallikrein
  • Plasma Prekallikrein
  • PPK

Background

Klkb1 is a serine protease that plays a role in blood coagulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1396
Species: Hu
Applications: WB
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP1-94203
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
MAB1569
Species: Hu
Applications: WB, IHC, IP
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-94203
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
MAB2337
Species: Hu
Applications: WB, IP
NBP2-57614
Species: Hu
Applications: ICC/IF
AF1669
Species: Hu
Applications: WB, IHC, IP, Neut
NBP2-13371
Species: Hu
Applications: IHC, IHC-P
NBP1-90367
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1267
Species: Hu
Applications: WB, IP, Neut
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
MAB24601
Species: Hu
Applications: WB, IP, Neut
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
AF1310
Species: Hu
Applications: WB, IHC, IP

Publications for Plasma Kallikrein/KLKB1 Antibody (NBP1-74210) (0)

There are no publications for Plasma Kallikrein/KLKB1 Antibody (NBP1-74210).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Plasma Kallikrein/KLKB1 Antibody (NBP1-74210) (0)

There are no reviews for Plasma Kallikrein/KLKB1 Antibody (NBP1-74210). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Plasma Kallikrein/KLKB1 Antibody (NBP1-74210) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Plasma Kallikrein/KLKB1 Products

Bioinformatics Tool for Plasma Kallikrein/KLKB1 Antibody (NBP1-74210)

Discover related pathways, diseases and genes to Plasma Kallikrein/KLKB1 Antibody (NBP1-74210). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Plasma Kallikrein/KLKB1 Antibody (NBP1-74210)

Discover more about diseases related to Plasma Kallikrein/KLKB1 Antibody (NBP1-74210).
 

Pathways for Plasma Kallikrein/KLKB1 Antibody (NBP1-74210)

View related products by pathway.

PTMs for Plasma Kallikrein/KLKB1 Antibody (NBP1-74210)

Learn more about PTMs related to Plasma Kallikrein/KLKB1 Antibody (NBP1-74210).

Blogs on Plasma Kallikrein/KLKB1

There are no specific blogs for Plasma Kallikrein/KLKB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Plasma Kallikrein/KLKB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLKB1
Entrez
Uniprot